Reaction Details |
| Report a problem with these data |
Target | MHC class II antigen |
---|
Ligand | BDBM50289264 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_192856 (CHEMBL799390) |
---|
IC50 | 430±n/a nM |
---|
Citation | Cunningham, BR; Rivetna, M; Tolman, RL; Flattery, SJ; Nichols, EA; Schwartz, CD; Wicker, LS; Hermes, JD; Jones, AB SAR for MHC class II binding tetrapeptides: Correlation with potential binding site Bioorg Med Chem Lett7:19-24 (1997) Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
MHC class II antigen |
---|
Name: | MHC class II antigen |
Synonyms: | DR-1 | DR1 | HLA class II histocompatibility antigen DRB1-1 | HLA class II histocompatibility antigen, DRB1-1 beta chain | Human leukocyte antigen DR beta chain | MHC class I antigen DRB1*1 |
Type: | PROTEIN |
Mol. Mass.: | 29917.79 |
Organism: | Homo sapiens (Human) |
Description: | ChEMBL_192854 |
Residue: | 266 |
Sequence: | MVCLKLPGGSCMTALTVTLMVLSSPLALAGDTRPRFLWQLKFECHFFNGTERVRLLERCI
YNQEESVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEQRRAAVDTYCRHNYGVGESFTV
QRRVEPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNG
DWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLL
FLGAGLFIYFRNQKGHSGLQPTGFLS
|
|
|
BDBM50289264 |
---|
n/a |
---|
Name | BDBM50289264 |
Synonyms: | (S)-4-Methyl-2-((S)-2-{(S)-3-methyl-2-[(S)-2-(4-oxo-pentanoylamino)-3-phenyl-propionylamino]-butyrylamino}-propionylamino)-pentanoic acid amide | CHEMBL80852 |
Type | Small organic molecule |
Emp. Form. | C28H43N5O6 |
Mol. Mass. | 545.6709 |
SMILES | CC(C)C[C@H](NC(=O)[C@H](C)NC(=O)[C@@H](NC(=O)[C@H](Cc1ccccc1)NC(=O)CCC(C)=O)C(C)C)C(N)=O |
Structure |
|