| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gag-Pol polyprotein [489-587] |
|---|
| Ligand | BDBM69 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_79984 |
|---|
| Ki | 16±n/a nM |
|---|
| Citation |  Smallheer, JM; McHugh, RJ; Chang, CH; Kaltenbach, RF; Worley, TV; Klabe, RM; Bacheler, LT; Rayner, MM; Erickson-Viitanen, S; Seitz, SP Functionalized aliphatic P2/P2′ analogs of HIV-1 protease inhibitor DMP323 Bioorg Med Chem Lett7:1365-1370 (1997) Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Gag-Pol polyprotein [489-587] |
|---|
| Name: | Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10781.16 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P04585[489-587] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM69 |
|---|
| n/a |
|---|
| Name | BDBM69 |
|---|
| Synonyms: | CHEMBL282395 | DMPC Cyclic Urea 49 | N-{5-[(4R,5S,6S,7R)-4,7-dibenzyl-5,6-dihydroxy-2-oxo-3-[5-(pyridin-4-ylformamido)pentyl]-1,3-diazepan-1-yl]pentyl}pyridine-4-carboxamide dihydrochloride |
|---|
| Type | n/a |
|---|
| Emp. Form. | C41H50N6O5 |
|---|
| Mol. Mass. | 706.8729 |
|---|
| SMILES | O[C@@H]1[C@@H](O)[C@@H](Cc2ccccc2)N(CCCCCNC(=O)c2ccncc2)C(=O)N(CCCCCNC(=O)c2ccncc2)[C@@H]1Cc1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
