| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Dual specificity protein phosphatase 3 |
|---|
| Ligand | BDBM50289900 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_152757 |
|---|
| IC50 | 10800±n/a nM |
|---|
| Citation |  Cebula, RE; Blanchard, JL; Boisclair, MD; Pal, K; Bockovich, NJ Synthesis and phosphatase inhibitory activity of analogs of sulfircin Bioorg Med Chem Lett7:2015-2020 (1997) Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Dual specificity protein phosphatase 3 |
|---|
| Name: | Dual specificity protein phosphatase 3 |
|---|
| Synonyms: | DUS3_HUMAN | DUSP3 | Dual specificity protein phosphatase (VHR) | Dual specificity protein phosphatase 3 | Dual specificity protein phosphatase VHR | Protein Tyrosine Phosphatase VHR | Tyrosine-protein phosphatase non-receptor type 1 | VHR |
|---|
| Type: | Hydrolase |
|---|
| Mol. Mass.: | 20480.58 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | n/a |
|---|
| Residue: | 185 |
|---|
| Sequence: | MSGSFELSVQDLNDLLSDGSGCYSLPSQPCNEVTPRIYVGNASVAQDIPKLQKLGITHVL
NAAEGRSFMHVNTNANFYKDSGITYLGIKANDTQEFNLSAYFERAADFIDQALAQKNGRV
LVHCREGYSRSPTLVIAYLMMRQKMDVKSALSIVRQNREIGPNDGFLAQLCQLNDRLAKE
GKLKP
|
|
|
|---|
| BDBM50289900 |
|---|
| n/a |
|---|
| Name | BDBM50289900 |
|---|
| Synonyms: | CHEMBL303581 | Sulfuric acid mono-[5-furan-3-yl-1-((1S,4aS,8aS)-2,5,5,8a-tetramethyl-1,4,4a,5,6,7,8,8a-octahydro-naphthalen-1-ylmethyl)-pentyl] ester |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C24H38O5S |
|---|
| Mol. Mass. | 438.621 |
|---|
| SMILES | CC1=CC[C@H]2C(C)(C)CCC[C@]2(C)[C@H]1CC(CCCCc1ccoc1)OS(O)(=O)=O |t:1| |
|---|
| Structure | 
|
|---|
Search and Browse
