new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCaspase-1
LigandBDBM50290015
Substrate/Competitorn/a
Meas. Tech.ChEBML_91011
Ki 150±n/a nM
Citation Golec JMMullican MDMurcko MAWilson KPKay DPJones SDMurdoch RBemis GWRaybuck SALuong YPLivingston DJ Structure-based design of non-peptidic pyridone aldehydes as inhibitors of interleukin-1β converting enzyme Bioorg Med Chem Lett 7:2181-2186 (1997)    Article
More Info.:Get all data from this article,  Assay Method
 
Caspase-1
Name:Caspase
Synonyms:Caspase 1 | ICE | Interleukin-1 beta convertase | Interleukin-1 beta-converting enzyme
Type:Enzyme
Mol. Mass.:45154.13
Organism:Homo sapiens (Human)
Description:P29466
Residue:404
Sequence:
MADKVLKEKRKLFIRSMGEGTINGLLDELLQTRVLNKEEMEKVKRENATVMDKTRALIDS
VIPKGAQACQICITYICEEDSYLAGTLGLSADQTSGNYLNMQDSQGVLSSFPAPQAVQDN
PAMPTSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRT
GAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIR
EGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACRGDSPGVVWFKDSVG
VSGNLSLPTTEEFEDDAIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEY
ACSCDVEEIFRKVRFSFEQPDGRAQMPTTERVTLTRCFYLFPGH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50290015
n/a
NameBDBM50290015
Synonyms:(S)-4-Oxo-3-{(S)-2-[2-oxo-3-(3-phenyl-propionylamino)-2H-pyridin-1-yl]-propionylamino}-butyric acid | CHEMBL308700
TypeSmall organic molecule
Emp. Form.C21H23N3O6
Mol. Mass.413.4238
SMILESC[C@@H](C(=O)N[C@@H](CC(O)=O)C=O)n1cccc(NC(=O)CCc2ccccc2)c1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: