| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gag-Pol polyprotein [489-587] |
|---|
| Ligand | BDBM50290520 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_79974 |
|---|
| Ki | 0.700000±n/a nM |
|---|
| Citation |  Choy, N; Choi, Hi; Jung, WH; Kim, CR; Yoon, H; Kim, SC; Lee, TG; Koh, JS Synthesis of irreversible HIV-1 protease inhibitors containing sulfonamide and sulfone as amide bond isosteres Bioorg Med Chem Lett7:2635-2638 (1997) Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Gag-Pol polyprotein [489-587] |
|---|
| Name: | Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10781.16 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P04585[489-587] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50290520 |
|---|
| n/a |
|---|
| Name | BDBM50290520 |
|---|
| Synonyms: | ((R)-1-{(S)-1-[(2R,3S)-3-(2-tert-Butylsulfamoyl-ethyl)-oxiranyl]-2-phenyl-ethylcarbamoyl}-2-methanesulfonyl-2-methyl-propyl)-carbamic acid benzyl ester | CHEMBL328956 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C30H43N3O8S2 |
|---|
| Mol. Mass. | 637.808 |
|---|
| SMILES | CC(C)(C)NS(=O)(=O)CC[C@@H]1O[C@@H]1[C@H](Cc1ccccc1)NC(=O)[C@@H](NC(=O)OCc1ccccc1)C(C)(C)S(C)(=O)=O |
|---|
| Structure | 
|
|---|
Search and Browse
