| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gag-Pol polyprotein [489-587] |
|---|
| Ligand | BDBM50291059 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_157558 |
|---|
| Ki | 19±n/a nM |
|---|
| Citation |  Schwartz, TM; Bundy, GL; Strohbach, JW; Thaisrivongs, S; Johnson, PD; Skulnick, HI; Tomich, PK; Lynn, JC; Chong, KT; Hinshaw, RR; Raub, TJ; Padbury, GE; Toth, LN Synthesis and pharmacological evaluation of sulfone substituted HIV protease inhibitors Bioorg Med Chem Lett7:399-402 (1997) Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Gag-Pol polyprotein [489-587] |
|---|
| Name: | Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10781.16 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P04585[489-587] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50291059 |
|---|
| n/a |
|---|
| Name | BDBM50291059 |
|---|
| Synonyms: | 6-(2-Cyclopropyl-1-cyclopropylmethyl-ethyl)-3-{cyclopropyl-[3-(4-fluoro-benzenesulfonylmethyl)-phenyl]-methyl}-4-hydroxy-pyran-2-one | CHEMBL131821 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C31H33FO5S |
|---|
| Mol. Mass. | 536.654 |
|---|
| SMILES | Oc1cc(oc(=O)c1C(C1CC1)c1cccc(CS(=O)(=O)c2ccc(F)cc2)c1)C(CC1CC1)CC1CC1 |
|---|
| Structure | 
|
|---|
Search and Browse
