new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMacrophage colony-stimulating factor 1 receptor
LigandBDBM50291109
Substrate/Competitorn/a
Meas. Tech.ChEBML_47907
IC50 1600±n/a nM
Citation Myers MRSetzer NNSpada APPersons PELy CQMaguire MPZulli ALCheney DLZilberstein AJohnson SEFranks CFMitchell KJ The synthesis and SAR of new 4-(N-alkyl-N-phenyl)amino-6,7-dimethoxyquinazolines and 4-(N-alkyl-N-phenyl)aminopyrazolo[3,4-Bioorg Med Chem Lett 7:421-424 (1997)    Article
More Info.:Get all data from this article,  Assay Method
 
Macrophage colony-stimulating factor 1 receptor
Name:Macrophage colony-stimulating factor 1 receptor
Synonyms:CSF1R | Fms proto-oncogene | Macrophage colony stimulating factor receptor | Macrophage colony-stimulating factor 1 receptor (CSF1R) | Macrophage colony-stimulating factor 1 receptor (FMS) | Macrophage colony-stimulating factor 1 receptor (c-FMS) | Macrophage colony-stimulating factor 1 receptor (cFMS) | Proto-oncogene c-Fms | Tyrosine Kinase CSF1-R | c-fms
Type:Tyrosine-protein kinase
Mol. Mass.:107979.48
Organism:Homo sapiens (Human)
Description:n/a
Residue:972
Sequence:
MGPGVLLLLLVATAWHGQGIPVIEPSVPELVVKPGATVTLRCVGNGSVEWDGPPSPHWTL
YSDGSSSILSTNNATFQNTGTYRCTEPGDPLGGSAAIHLYVKDPARPWNVLAQEVVVFED
QDALLPCLLTDPVLEAGVSLVRVRGRPLMRHTNYSFSPWHGFTIHRAKFIQSQDYQCSAL
MGGRKVMSISIRLKVQKVIPGPPALTLVPAELVRIRGEAAQIVCSASSVDVNFDVFLQHN
NTKLAIPQQSDFHNNRYQKVLTLNLDQVDFQHAGNYSCVASNVQGKHSTSMFFRVVESAY
LNLSSEQNLIQEVTVGEGLNLKVMVEAYPGLQGFNWTYLGPFSDHQPEPKLANATTKDTY
RHTFTLSLPRLKPSEAGRYSFLARNPGGWRALTFELTLRYPPEVSVIWTFINGSGTLLCA
ASGYPQPNVTWLQCSGHTDRCDEAQVLQVWDDPYPEVLSQEPFHKVTVQSLLTVETLEHN
QTYECRAHNSVGSGSWAFIPISAGAHTHPPDEFLFTPVVVACMSIMALLLLLLLLLLYKY
KQKPKYQVRWKIIESYEGNSYTFIDPTQLPYNEKWEFPRNNLQFGKTLGAGAFGKVVEAT
AFGLGKEDAVLKVAVKMLKSTAHADEKEALMSELKIMSHLGQHENIVNLLGACTHGGPVL
VITEYCCYGDLLNFLRRKAEAMLGPSLSPGQDPEGGVDYKNIHLEKKYVRRDSGFSSQGV
DTYVEMRPVSTSSNDSFSEQDLDKEDGRPLELRDLLHFSSQVAQGMAFLASKNCIHRDVA
ARNVLLTNGHVAKIGDFGLARDIMNDSNYIVKGNARLPVKWMAPESIFDCVYTVQSDVWS
YGILLWEIFSLGLNPYPGILVNSKFYKLVKDGYQMAQPAFAPKNIYSIMQACWALEPTHR
PTFQQICSFLQEQAQEDRRERDYTNLPSSSRSGGSGSSSSELEEESSSEHLTCCEQGDIA
QPLLQPNNYQFC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50291109
n/a
NameBDBM50291109
Synonyms:(6,7-Dimethyl-quinazolin-4-yl)-methyl-m-tolyl-amine; hydrochloride | CHEMBL554566
TypeSmall organic molecule
Emp. Form.C18H19N3
Mol. Mass.277.3636
SMILESCN(c1cccc(C)c1)c1ncnc2cc(C)c(C)cc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: