Reaction Details |
| Report a problem with these data |
Target | Cytosol aminopeptidase [33-68,L62W] |
---|
Ligand | BDBM7459 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_546423 (CHEMBL1025822) |
---|
IC50 | 49600±n/a nM |
---|
Citation | Parellada, J; Guinea, M Flavonoid Inhibitors of Trypsin and Leucine Aminopeptidase: A Proposed Mathematical Model for IC50 Estimation J Nat Prod58:823-829 (1995) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Cytosol aminopeptidase [33-68,L62W] |
---|
Name: | Cytosol aminopeptidase [33-68,L62W] |
Synonyms: | AMPL_PIG | Cytosol aminopeptidase | LAP3 | Leucine aminopeptidase (LAP) |
Type: | Enzyme |
Mol. Mass.: | 4015.44 |
Organism: | Sus scrofa (Pig) |
Description: | P28839[33-68,L62W] |
Residue: | 36 |
Sequence: | TKGLVLGIYSKEKEDDAPQFTSAGENFDKWVSGKLR
|
|
|
BDBM7459 |
---|
n/a |
---|
Name | BDBM7459 |
Synonyms: | 2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-4H-chromen-4-one | 2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-chromen-4-one | CHEMBL151 | Luteolin (27) | Luteolin (4) | acs.jmedchem.1c00409_ST.600 | cid_5280445 | luteolin | med.21724, Compound 3 |
Type | Small organic molecule |
Emp. Form. | C15H10O6 |
Mol. Mass. | 286.2363 |
SMILES | Oc1cc(O)c2c(c1)oc(cc2=O)-c1ccc(O)c(O)c1 |
Structure |
|