| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Cytosol aminopeptidase [33-68,L62W] |
|---|
| Ligand | BDBM7459 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_546423 (CHEMBL1025822) |
|---|
| IC50 | 49600±n/a nM |
|---|
| Citation |  Parellada, J; Guinea, M Flavonoid Inhibitors of Trypsin and Leucine Aminopeptidase: A Proposed Mathematical Model for IC50 Estimation J Nat Prod58:823-829 (1995) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Cytosol aminopeptidase [33-68,L62W] |
|---|
| Name: | Cytosol aminopeptidase [33-68,L62W] |
|---|
| Synonyms: | AMPL_PIG | Cytosol aminopeptidase | LAP3 | Leucine aminopeptidase (LAP) |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 4015.44 |
|---|
| Organism: | Sus scrofa (Pig) |
|---|
| Description: | P28839[33-68,L62W] |
|---|
| Residue: | 36 |
|---|
| Sequence: | TKGLVLGIYSKEKEDDAPQFTSAGENFDKWVSGKLR
|
|
|
|---|
| BDBM7459 |
|---|
| n/a |
|---|
| Name | BDBM7459 |
|---|
| Synonyms: | 2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-4H-chromen-4-one | 2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-chromen-4-one | CHEMBL151 | Luteolin (27) | Luteolin (4) | acs.jmedchem.1c00409_ST.600 | cid_5280445 | luteolin | med.21724, Compound 3 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C15H10O6 |
|---|
| Mol. Mass. | 286.2363 |
|---|
| SMILES | Oc1cc(O)c2c(c1)oc(cc2=O)-c1ccc(O)c(O)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
