Reaction Details |
| Report a problem with these data |
Target | Nociceptin receptor |
---|
Ligand | BDBM50295451 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_578685 (CHEMBL1063066) |
---|
Ki | 2±n/a nM |
---|
Citation | Yang, SW; Ho, G; Tulshian, D; Greenlee, WJ; Anthes, J; Fernandez, X; McLeod, RL; Hey, JA; Xu, X Discovery of orally active 3-pyridinyl-tropane as a potent nociceptin receptor agonist for the management of cough. J Med Chem52:5323-9 (2009) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Nociceptin receptor |
---|
Name: | Nociceptin receptor |
Synonyms: | KOR-3 | Kappa-type 3 opioid receptor | Mu-type opioid receptor (Mu) | NOP | Nociceptin Receptor (ORL1 Receptor) | Nociceptin receptor (NOP) | Nociceptin receptor (ORL-1) | Nociceptin receptor (ORL1) | Nociceptin/Orphanin FQ, NOP receptor | OOR | OPIATE ORL-1 | OPRL1 | OPRL1 protein | OPRX_HUMAN | ORL1 | ORL1 receptor | Opioid receptor like-1 | Orphanin FQ receptor | Orphanin FQ receptor (ORL1) | P41146 |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 40702.87 |
Organism: | Homo sapiens (Human) |
Description: | P41146 |
Residue: | 370 |
Sequence: | MEPLFPAPFWEVIYGSHLQGNLSLLSPNHSLLPPHLLLNASHGAFLPLGLKVTIVGLYLA
VCVGGLLGNCLVMYVILRHTKMKTATNIYIFNLALADTLVLLTLPFQGTDILLGFWPFGN
ALCKTVIAIDYYNMFTSTFTLTAMSVDRYVAICHPIRALDVRTSSKAQAVNVAIWALASV
VGVPVAIMGSAQVEDEEIECLVEIPTPQDYWGPVFAICIFLFSFIVPVLVISVCYSLMIR
RLRGVRLLSGSREKDRNLRRITRLVLVVVAVFVGCWTPVQVFVLAQGLGVQPSSETAVAI
LRFCTALGYVNSCLNPILYAFLDENFKACFRKFCCASALRRDVQVSDRVRSIAKDVALAC
KTSETVPRPA
|
|
|
BDBM50295451 |
---|
n/a |
---|
Name | BDBM50295451 |
Synonyms: | CHEMBL561373 | exo-8-[Bis(2-chlorophenyl)methyl]-3-(2-piperidinyl)-8-azabicyclo[3.2.1]octane |
Type | Small organic molecule |
Emp. Form. | C25H30Cl2N2 |
Mol. Mass. | 429.425 |
SMILES | Clc1ccccc1C(N1[C@H]2CC[C@H]1CC(C2)C1CCCCN1)c1ccccc1Cl |r,TLB:7:8:14.15.13:10.11,THB:16:14:8:10.11| |
Structure |
|