Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetN-formyl peptide receptor 2
LigandBDBM50295525
Substrate/Competitorn/a
Meas. Tech.ChEMBL_580005
EC50 118±n/a nM
Citation Cilibrizzi AQuinn MTKirpotina LNSchepetkin IAHolderness JYe RDRabiet MJBiancalani CCesari NGraziano AVergelli CPieretti SDal Piaz VGiovannoni MP 6-methyl-2,4-disubstituted pyridazin-3(2H)-ones: a novel class of small-molecule agonists for formyl peptide receptors. J Med Chem 52:5044-57 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
N-formyl peptide receptor 2
Name:N-formyl peptide receptor 2
Synonyms:ALXR, FPRL1, FPR2 | FMLP-related receptor I FMLP-R-I | Formyl Peptide Receptor-Like 1 | HM63 | LXA4 receptor | Lipoxin A4 receptor | Lipoxin A4 receptor (LXA4) | RFP | hFPRL
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:38968.35
Organism:Homo sapiens (Human)
Description:n/a
Residue:351
Sequence:
METNFSTPLNEYEEVSYESAGYTVLRILPLVVLGVTFVLGVLGNGLVIWVAGFRMTRTVT
TICYLNLALADFSFTATLPFLIVSMAMGEKWPFGWFLCKLIHIVVDINLFGSVFLIGFIA
LDRCICVLHPVWAQNHRTVSLAMKVIVGPWILALVLTLPVFLFLTTVTIPNGDTYCTFNF
ASWGGTPEERLKVAITMLTARGIIRFVIGFSLPMSIVAICYGLIAAKIHKKGMIKSSRPL
RVLTAVVASFFICWFPFQLVALLGTVWLKEMLFYGKYKIIDILVNPTSSLAFFNSCLNPM
LYVFVGQDFRERLIHSLPTSLERALSEDSAPTNDTAANSASPPAETELQAM
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50295525
n/a
NameBDBM50295525
Synonyms:CHEMBL551590 | N-(4-Bromophenyl)-3-[3-(3-methoxybenzyl)-5-methyl-2-oxo-2H-pyridazin-1-yl]-propionamide
TypeSmall organic molecule
Emp. Form.C22H22BrN3O3
Mol. Mass.456.332
SMILESCOc1cccc(Cc2cc(C)nn(CCC(=O)Nc3ccc(Br)cc3)c2=O)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: