| Reaction Details |
|---|
 | Report a problem with these data |
| Target | N-formyl peptide receptor 2 |
|---|
| Ligand | BDBM50050937 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_580002 (CHEMBL1051690) |
|---|
| EC50 | 20400±n/a nM |
|---|
| Citation |  Cilibrizzi, A; Quinn, MT; Kirpotina, LN; Schepetkin, IA; Holderness, J; Ye, RD; Rabiet, MJ; Biancalani, C; Cesari, N; Graziano, A; Vergelli, C; Pieretti, S; Dal Piaz, V; Giovannoni, MP 6-methyl-2,4-disubstituted pyridazin-3(2H)-ones: a novel class of small-molecule agonists for formyl peptide receptors. J Med Chem52:5044-57 (2010) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| N-formyl peptide receptor 2 |
|---|
| Name: | N-formyl peptide receptor 2 |
|---|
| Synonyms: | ALXR, FPRL1, FPR2 | FMLP-related receptor I FMLP-R-I | FPR2 | FPR2_HUMAN | FPRH1 | FPRL1 | Formyl Peptide Receptor-Like 1 | HM63 | LXA4 receptor | LXA4R | Lipoxin A4 receptor | Lipoxin A4 receptor (LXA4) | RFP | hFPRL |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 38968.35 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P25090 |
|---|
| Residue: | 351 |
|---|
| Sequence: | METNFSTPLNEYEEVSYESAGYTVLRILPLVVLGVTFVLGVLGNGLVIWVAGFRMTRTVT
TICYLNLALADFSFTATLPFLIVSMAMGEKWPFGWFLCKLIHIVVDINLFGSVFLIGFIA
LDRCICVLHPVWAQNHRTVSLAMKVIVGPWILALVLTLPVFLFLTTVTIPNGDTYCTFNF
ASWGGTPEERLKVAITMLTARGIIRFVIGFSLPMSIVAICYGLIAAKIHKKGMIKSSRPL
RVLTAVVASFFICWFPFQLVALLGTVWLKEMLFYGKYKIIDILVNPTSSLAFFNSCLNPM
LYVFVGQDFRERLIHSLPTSLERALSEDSAPTNDTAANSASPPAETELQAM
|
|
|
|---|
| BDBM50050937 |
|---|
| n/a |
|---|
| Name | BDBM50050937 |
|---|
| Synonyms: | (S)-2-[(S)-2-((S)-2-Formylamino-4-methylsulfanyl-butyrylamino)-4-methyl-pentanoylamino]-3-phenyl-propionic acid | CHEMBL267179 | N-formyl-methionyl-leucyl-phenylalanine | N-formylmethionine-leucine-phenylalanine |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H31N3O5S |
|---|
| Mol. Mass. | 437.553 |
|---|
| SMILES | CSCC[C@H](NC=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](Cc1ccccc1)C(O)=O |
|---|
| Structure | 
|
|---|
Search and Browse
