Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarbonic anhydrase 15
LigandBDBM50237710
Substrate/Competitorn/a
Meas. Tech.ChEMBL_579804
Ki 79±n/a nM
Citation Parkkila SInnocenti AKallio HHilvo MScozzafava ASupuran CT The protein tyrosine kinase inhibitors imatinib and nilotinib strongly inhibit several mammalian alpha-carbonic anhydrase isoforms. Bioorg Med Chem Lett 19:4102-6 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Carbonic anhydrase 15
Name:Carbonic anhydrase 15
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:35484.02
Organism:Mus musculus
Description:ChEMBL_651955
Residue:324
Sequence:
MWALDFLLSFLLIQLAAQVDSSGTWCYDSQDPKCGPAHWKELAPACGGPTQSPINIDLRL
VQRDYTLKPFIFQGYDSAPQDPWVLENDGHTVLLRVNSCQQNCPAIRGAGLPSPEYRLLQ
LHFHWGSPGHQGSEHSLDEKHGSMEMHMVHMNTKYQSMEDARSQPDGFAILAVLLVEEDR
DNTNFSAIVSGLKNLSSPGVAVNLTSTFALASLLPSALRLLRYYRYSGSLTTPGCEPAVL
WTVFENTVPIGHAQVVQFQAVLQTGPPGLHPRPLTSNFRPQQPLGGRRISASPEASVRSS
VSTLPCLHLALVGLGVGLRLWQGP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50237710
n/a
NameBDBM50237710
Synonyms:4-methyl-N-[3-(4-methyl-1H-imidazol-1-yl)-5-(trifluoromethyl)phenyl]-3-[(4-pyridin-3-ylpyrimidin-2-yl)amino]benzamide | AMN 107 | AMN107 | CHEMBL255863 | NILOTINIB
TypeSmall organic molecule
Emp. Form.C28H22F3N7O
Mol. Mass.529.5158
SMILESCc1cn(cn1)-c1cc(NC(=O)c2ccc(C)c(Nc3nccc(n3)-c3cccnc3)c2)cc(c1)C(F)(F)F
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: