Reaction Details |
| Report a problem with these data |
Target | Adenosine receptor A3 |
---|
Ligand | BDBM50109489 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_587704 (CHEMBL1037718) |
---|
Ki | 0.34±n/a nM |
---|
Citation | Michielan, L; Bolcato, C; Federico, S; Cacciari, B; Bacilieri, M; Klotz, KN; Kachler, S; Pastorin, G; Cardin, R; Sperduti, A; Spalluto, G; Moro, S Combining selectivity and affinity predictions using an integrated Support Vector Machine (SVM) approach: An alternative tool to discriminate between the human adenosine A(2A) and A(3) receptor pyrazolo-triazolo-pyrimidine antagonists binding sites. Bioorg Med Chem17:5259-74 (2009) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Adenosine receptor A3 |
---|
Name: | Adenosine receptor A3 |
Synonyms: | A3 adenosine receptor (hA3) | AA3R_HUMAN | ADORA3 | Adenosine A3 receptor (A3AR) |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 36197.32 |
Organism: | Homo sapiens (Human) |
Description: | P0DMS8 |
Residue: | 318 |
Sequence: | MPNNSTALSLANVTYITMEIFIGLCAIVGNVLVICVVKLNPSLQTTTFYFIVSLALADIA
VGVLVMPLAIVVSLGITIHFYSCLFMTCLLLIFTHASIMSLLAIAVDRYLRVKLTVRYKR
VTTHRRIWLALGLCWLVSFLVGLTPMFGWNMKLTSEYHRNVTFLSCQFVSVMRMDYMVYF
SFLTWIFIPLVVMCAIYLDIFYIIRNKLSLNLSNSKETGAFYGREFKTAKSLFLVLFLFA
LSWLPLSIINCIIYFNGEVPQLVLYMGILLSHANSMMNPIVYAYKIKKFKETYLLILKAC
VVCHPSDSLDTSIEKNSE
|
|
|
BDBM50109489 |
---|
n/a |
---|
Name | BDBM50109489 |
Synonyms: | 1-(2-(furan-2-yl)-8-propyl-8H-pyrazolo[4,3-e][1,2,4]triazolo[1,5-c]pyrimidin-5-yl)-3-(2-methoxyphenyl)urea | 1-(2-Furan-2-yl-8-propyl-8H-pyrazolo[4,3-e][1,2,4]triazolo[1,5-c]pyrimidin-5-yl)-3-(2-methoxy-phenyl)-urea | CHEMBL165560 |
Type | Small organic molecule |
Emp. Form. | C21H20N8O3 |
Mol. Mass. | 432.4353 |
SMILES | CCCn1cc2c(n1)nc(NC(=O)Nc1ccccc1OC)n1nc(nc21)-c1ccco1 |
Structure |
|