Reaction Details |
| Report a problem with these data |
Target | Sigma non-opioid intracellular receptor 1 |
---|
Ligand | BDBM50299286 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_589788 (CHEMBL1051411) |
---|
Ki | 37±n/a nM |
---|
Citation | Maestrup, EG; Fischer, S; Wiese, C; Schepmann, D; Hiller, A; Deuther-Conrad, W; Steinbach, J; Wünsch, B; Brust, P Evaluation of spirocyclic 3-(3-fluoropropyl)-2-benzofurans as sigma1 receptor ligands for neuroimaging with positron emission tomography. J Med Chem52:6062-72 (2009) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sigma non-opioid intracellular receptor 1 |
---|
Name: | Sigma non-opioid intracellular receptor 1 |
Synonyms: | OPRS1 | SGMR1_CAVPO | SIGMAR1 | Sigma 1-type opioid receptor | Sigma non-opioid intracellular receptor 1 | Sigma-1 receptor | Sigma1-receptor | Sigma1R | Sterol isomerase-like protein |
Type: | Protein |
Mol. Mass.: | 25307.17 |
Organism: | Cavia porcellus (Guinea pig) |
Description: | Q60492 |
Residue: | 223 |
Sequence: | MQWAVGRRWLWVALFLAAVAVLTQIVWLWLGTQNFVFQREEIAQLARQYAGLDHELAFSK
LIVELRRLHPVHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSPRHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLGFALADTVFSTQDFLTLFYTLRVYARALQLELTTYLFGQDP
|
|
|
BDBM50299286 |
---|
n/a |
---|
Name | BDBM50299286 |
Synonyms: | 3-(3-Fluoropropyl)-1'-octyl-3H-spiro[[2]benzofuran-1,4'-piperidine] | CHEMBL574235 |
Type | Small organic molecule |
Emp. Form. | C23H36FNO |
Mol. Mass. | 361.5364 |
SMILES | CCCCCCCCN1CCC2(CC1)OC(CCCF)c1ccccc21 |
Structure |
|