Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDelta-type opioid receptor
LigandBDBM50299393
Substrate/Competitorn/a
Meas. Tech.ChEMBL_590499
Ki 0.290000±n/a nM
Citation Griffin AMBrown WWalpole CCoupal MAdam LGosselin MSalois DMorin PERoumi M Delta agonist hydroxy bioisosteres: the discovery of 3-((1-benzylpiperidin-4-yl){4-[(diethylamino)carbonyl]phenyl}amino)benzamide with improved delta agonist activity and in vitro metabolic stability. Bioorg Med Chem Lett 19:5999-6003 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Delta-type opioid receptor
Name:Delta-type opioid receptor
Synonyms:D-OR-1 | DOR-1 | Delta-type opioid receptor (Delta) | OPIATE Delta | OPRD | OPRD1 | OPRK1 | opioid receptor, delta 1
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:40382.98
Organism:Homo sapiens (Human)
Description:Competition binding assays were carried out using membrane preparations from transfected HN9.10 cells that constitutively expressed the delta opioid receptor.
Residue:372
Sequence:
MEPAPSAGAELQPPLFANASDAYPSACPSAGANASGPPGARSASSLALAIAITALYSAVC
AVGLLGNVLVMFGIVRYTKMKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL
CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG
VPIMVMAVTRPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL
RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDIDRRDPLVVAAL
HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRKPCGRPDPSSFSRAREATARERVTAC
TPSDGPGGGAAA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50299393
n/a
NameBDBM50299393
Synonyms:4-((1-benzylpiperidin-4-yl)(3-carbamoylphenyl)amino)-N,N-diethylbenzamide | CHEMBL577615
TypeSmall organic molecule
Emp. Form.C30H36N4O2
Mol. Mass.484.6324
SMILESCCN(CC)C(=O)c1ccc(cc1)N(C1CCN(Cc2ccccc2)CC1)c1cccc(c1)C(N)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: