Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetUrotensin II receptor
LigandBDBM50302267
Substrate/Competitorn/a
Meas. Tech.ChEMBL_596666
Ki 11±n/a nM
Citation Lawson ECLuci DKGhosh SKinney WAReynolds CHQi JSmith CEWang YMinor LKHaertlein BJParry TJDamiano BPMaryanoff BE Nonpeptide urotensin-II receptor antagonists: a new ligand class based on piperazino-phthalimide and piperazino-isoindolinone subunits. J Med Chem 52:7432-45 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Urotensin II receptor
Name:Urotensin II receptor
Synonyms:G-protein coupled receptor 14 | UR-II-R | Urotensin-II
Type:Enzyme Catalytic Domain
Mol. Mass.:42159.71
Organism:Homo sapiens (Human)
Description:Urotensin-II UTS2R HUMAN::Q9UKP6
Residue:389
Sequence:
MALTPESPSSFPGLAATGSSVPEPPGGPNATLNSSWASPTEPSSLEDLVATGTIGTLLSA
MGVVGVVGNAYTLVVTCRSLRAVASMYVYVVNLALADLLYLLSIPFIVATYVTKEWHFGD
VGCRVLFGLDFLTMHASIFTLTVMSSERYAAVLRPLDTVQRPKGYRKLLALGTWLLALLL
TLPVMLAMRLVRRGPKSLCLPAWGPRAHRAYLTLLFATSIAGPGLLIGLLYARLARAYRR
SQRASFKRARRPGARALRLVLGIVLLFWACFLPFWLWQLLAQYHQAPLAPRTARIVNYLT
TCLTYGNSCANPFLYTLLTRNYRDHLRGRVRGPGSGGGRGPVPSLQPRARFQRCSGRSLS
SCSPQPTDSLVLAPAAPARPAPEGPRAPA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50302267
n/a
NameBDBM50302267
Synonyms:(R)-N-(4-(3,4-dimethoxyphenyl)-4-(4-(4-ethylpiperazin-1-yl)-1-oxoisoindolin-2-yl)butyl)-3,5-dimethyl-1H-pyrazole-4-carboxamide | CHEMBL578205
TypeSmall organic molecule
Emp. Form.C32H42N6O4
Mol. Mass.574.7137
SMILESCCN1CCN(CC1)c1cccc2C(=O)N(Cc12)[C@H](CCCNC(=O)c1c(C)n[nH]c1C)c1ccc(OC)c(OC)c1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: