| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Serine/threonine-protein kinase pim-1 |
|---|
| Ligand | BDBM80396 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_596755 (CHEMBL1039043) |
|---|
| Kd | 130±n/a nM |
|---|
| Citation |  Mott, BT; Tanega, C; Shen, M; Maloney, DJ; Shinn, P; Leister, W; Marugan, JJ; Inglese, J; Austin, CP; Misteli, T; Auld, DS; Thomas, CJ Evaluation of substituted 6-arylquinazolin-4-amines as potent and selective inhibitors of cdc2-like kinases (Clk). Bioorg Med Chem Lett19:6700-5 (2009) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Serine/threonine-protein kinase pim-1 |
|---|
| Name: | Serine/threonine-protein kinase pim-1 |
|---|
| Synonyms: | PIM-1 Kinase | PIM1 | PIM1_HUMAN | Proto-oncogene serine/threonine-protein kinase Pim-1 | Serine/threonine-protein kinase (PIM1) | Serine/threonine-protein kinase PIM | Serine/threonine-protein kinase PIM1 | Serine/threonine-protein kinase pim-1 (PIM1) |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 35681.82 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P11309 |
|---|
| Residue: | 313 |
|---|
| Sequence: | MLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVSD
NLPVAIKHVEKDRISDWGELPNGTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLIL
ERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCHNCGVLHRDIKDENILIDLNRG
ELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDI
PFEHDEEIIRGQVFFRQRVSSECQHLIRWCLALRPSDRPTFEEIQNHPWMQDVLLPQETA
EIHLHSLSPGPSK
|
|
|
|---|
| BDBM80396 |
|---|
| n/a |
|---|
| Name | BDBM80396 |
|---|
| Synonyms: | (1E)-1-(3-ethyl-5-methoxy-1,3-benzothiazol-2-ylidene)-2-propanone | (1E)-1-(3-ethyl-5-methoxy-1,3-benzothiazol-2-ylidene)acetone | (1E)-1-(3-ethyl-5-methoxy-1,3-benzothiazol-2-ylidene)propan-2-one | CHEMBL408982 | MLS000518915 | SMR000129335 | cid_1893667 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C13H15NO2S |
|---|
| Mol. Mass. | 249.329 |
|---|
| SMILES | CCN1C(Sc2ccc(OC)cc12)=CC(C)=O |w:13.15| |
|---|
| Structure | 
|
|---|
Search and Browse
