Reaction Details |
| Report a problem with these data |
Target | Dual specificity protein phosphatase 3 |
---|
Ligand | BDBM50303192 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_595099 (CHEMBL1047959) |
---|
Ki | 15900±n/a nM |
---|
Citation | Wu, S; Vossius, S; Rahmouni, S; Miletic, AV; Vang, T; Vazquez-Rodriguez, J; Cerignoli, F; Arimura, Y; Williams, S; Hayes, T; Moutschen, M; Vasile, S; Pellecchia, M; Mustelin, T; Tautz, L Multidentate small-molecule inhibitors of vaccinia H1-related (VHR) phosphatase decrease proliferation of cervix cancer cells. J Med Chem52:6716-23 (2009) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Dual specificity protein phosphatase 3 |
---|
Name: | Dual specificity protein phosphatase 3 |
Synonyms: | DUS3_HUMAN | DUSP3 | Dual specificity protein phosphatase (VHR) | Dual specificity protein phosphatase 3 | Dual specificity protein phosphatase VHR | Protein Tyrosine Phosphatase VHR | Tyrosine-protein phosphatase non-receptor type 1 | VHR |
Type: | Hydrolase |
Mol. Mass.: | 20480.58 |
Organism: | Homo sapiens (Human) |
Description: | n/a |
Residue: | 185 |
Sequence: | MSGSFELSVQDLNDLLSDGSGCYSLPSQPCNEVTPRIYVGNASVAQDIPKLQKLGITHVL
NAAEGRSFMHVNTNANFYKDSGITYLGIKANDTQEFNLSAYFERAADFIDQALAQKNGRV
LVHCREGYSRSPTLVIAYLMMRQKMDVKSALSIVRQNREIGPNDGFLAQLCQLNDRLAKE
GKLKP
|
|
|
BDBM50303192 |
---|
n/a |
---|
Name | BDBM50303192 |
Synonyms: | 1-(5-(3,4-dichlorophenyl)furan-2-yl)-5-(furan-2-yl)penta-1,4-dien-3-one | CHEMBL565606 |
Type | Small organic molecule |
Emp. Form. | C19H12Cl2O3 |
Mol. Mass. | 359.203 |
SMILES | Clc1ccc(cc1Cl)-c1ccc(\C=C\C(=O)\C=C\c2ccco2)o1 |
Structure |
|