Reaction Details |
| Report a problem with these data |
Target | Cannabinoid receptor 2 |
---|
Ligand | BDBM50303838 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_594921 (CHEMBL1041654) |
---|
Ki | >1000±n/a nM |
---|
Citation | Lange, JH; Coolen, HK; van der Neut, MA; Borst, AJ; Stork, B; Verveer, PC; Kruse, CG Design, synthesis, biological properties, and molecular modeling investigations of novel tacrine derivatives with a combination of acetylcholinesterase inhibition and cannabinoid CB1 receptor antagonism. J Med Chem53:1338-46 (2010) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Cannabinoid receptor 2 |
---|
Name: | Cannabinoid receptor 2 |
Synonyms: | CANNABINOID CB2 | CB-2 | CB2 | CB2A | CB2B | CNR2 | CNR2_HUMAN | CX5 | Cannabinoid CB2 receptor | Cannabinoid receptor 2 (CB2) | Cannabinoid receptor 2 (CB2R) | hCB2 |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 39690.94 |
Organism: | Homo sapiens (Human) |
Description: | P34972 |
Residue: | 360 |
Sequence: | MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILS
SHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTAS
VGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCS
ELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLD
VRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYA
LRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC
|
|
|
BDBM50303838 |
---|
n/a |
---|
Name | BDBM50303838 |
Synonyms: | 3-(4-Chlorophenyl)-N'-((4-chlorophenyl)sulfonyl)-N-[4-(pyrrolidin-1-yl)butyl]-4-phenyl-4,5-dihydro-1H-pyrazole-1-carboxamidine | CHEMBL576673 |
Type | Small organic molecule |
Emp. Form. | C30H33Cl2N5O2S |
Mol. Mass. | 598.586 |
SMILES | Clc1ccc(cc1)C1=NN(CC1c1ccccc1)C(NS(=O)(=O)c1ccc(Cl)cc1)=NCCCCN1CCCC1 |w:30.34,t:8| |
Structure |
|