| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Phospholipase A2, major isoenzyme |
|---|
| Ligand | BDBM50304128 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_602199 (CHEMBL1044736) |
|---|
| IC50 | >250000±n/a nM |
|---|
| Citation |  Obando, D; Pantarat, N; Handke, R; Koda, Y; Widmer, F; Djordjevic, JT; Ellis, DH; Sorrell, TC; Jolliffe, KA Synthesis, antifungal, haemolytic and cytotoxic activities of a series of bis(alkylpyridinium)alkanes. Bioorg Med Chem17:6329-39 (2009) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Phospholipase A2, major isoenzyme |
|---|
| Name: | Phospholipase A2, major isoenzyme |
|---|
| Synonyms: | Group IB phospholipase A2 | PA21B_PIG | PLA2G1B | Phosphatidylcholine 2-acylhydrolase | Phospholipase A2 |
|---|
| Type: | Hydrolase; monomer or homodimer |
|---|
| Mol. Mass.: | 16279.83 |
|---|
| Organism: | Sus scrofa (pig) |
|---|
| Description: | Purchased from Sigma. |
|---|
| Residue: | 146 |
|---|
| Sequence: | MKFLVLAVLLTVGAAQEGISSRALWQFRSMIKCAIPGSHPLMDFNNYGCYCGLGGSGTPV
DELDRCCETHDNCYRDAKNLDSCKFLVDNPYTESYSYSCSNTEITCNSKNNACEAFICNC
DRNAAICFSKAPYNKEHKNLDTKKYC
|
|
|
|---|
| BDBM50304128 |
|---|
| n/a |
|---|
| Name | BDBM50304128 |
|---|
| Synonyms: | 1,12-Bis(4'-pentylpyridinium)dodecane dichloride | 1,12-bis(4-pentylpyridinium)dodecane dichloride | CHEMBL412304 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C32H54N2 |
|---|
| Mol. Mass. | 466.7835 |
|---|
| SMILES | CCCCCc1cc[n+](CCCCCCCCCCCC[n+]2ccc(CCCCC)cc2)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
