Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAbhydrolase Domain-Containing Protein 6
LigandBDBM50307060
Substrate/Competitorn/a
Meas. Tech.ChEMBL_609360
IC50 490±n/a nM
Citation Long JZJin XAdibekian ALi WCravatt BF Characterization of tunable piperidine and piperazine carbamates as inhibitors of endocannabinoid hydrolases. J Med Chem 53:1830-42 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Abhydrolase Domain-Containing Protein 6
Name:Monoacylglycerol lipase ABHD6
Synonyms:Abh6
Type:Single-pass type II membrane protein; hydrolase
Mol. Mass.:38216.17
Organism:Mus musculus (mouse)
Description:Assays were using membranes of recombinant Abh6 transiently transfected in COS-7 cells.
Residue:336
Sequence:
MDLDVVNMFVIAGGTLAIPILAFVASFLLWPSALIRIYYWYWRRTLGMQVRYAHHEDYQF
CYSFRGRPGHKPSILMLHGFSAHKDMWLSVVKFLPKNLHLVCVDMPGHEGTTRSSLDDLS
IVGQVKRIHQFVECLKLNKKPFHLIGTSMGGHVAGVYAAYYPSDVCSLSLVCPAGLQYST
DNPFVQRLKELEESAAIQKIPLIPSTPEEMSEMLQLCSYVRFKVPQQILQGLVDVRIPHN
SFYRKLFLEIVNEKSRYSLHENMDKIKVPTQIIWGKQDQVLDVSGADILAKSISNSQVEV
LENCGHSVVMERPRKTAKLIVDFLASVHNTDNKKLN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50307060
n/a
NameBDBM50307060
Synonyms:4-Nitrophenyl 4-(Quinolin-2-ylmethyl)piperazine-1-carboxylate | CHEMBL597699
TypeSmall organic molecule
Emp. Form.C21H20N4O4
Mol. Mass.392.4079
SMILES[O-][N+](=O)c1ccc(OC(=O)N2CCN(Cc3ccc4ccccc4n3)CC2)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: