| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Bcl-2-like protein 1 |
|---|
| Ligand | BDBM50308110 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_610767 (CHEMBL1064402) |
|---|
| Ki | 3400±n/a nM |
|---|
| Citation |  Bernardo, PH; Sivaraman, T; Wan, KF; Xu, J; Krishnamoorthy, J; Song, CM; Tian, L; Chin, JS; Lim, DS; Mok, HY; Yu, VC; Tong, JC; Chai, CL Structural insights into the design of small molecule inhibitors that selectively antagonize Mcl-1. J Med Chem53:2314-8 (2010) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Bcl-2-like protein 1 |
|---|
| Name: | Bcl-2-like protein 1 |
|---|
| Synonyms: | Anti-apoptotic Bcl-2 protein | Apoptosis Regulator Bcl-xL | Apoptosis regulator Bcl-X | B2CL1_HUMAN | BCL2-like 1 isoform 1 | BCL2L | BCL2L1 | BCLX | Bcl-2-like protein 1 (Bcl-XL) | Bcl-X | Bcl-xL/Bcl-2-binding component 3 | Bcl2-L-1 | Bcl2-antagonist of cell death (BAD) |
|---|
| Type: | Mitochondrion membrane; Single-pass membrane protein |
|---|
| Mol. Mass.: | 26039.60 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | n/a |
|---|
| Residue: | 233 |
|---|
| Sequence: | MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLA
DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY
QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEP
WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
|
|
|
|---|
| BDBM50308110 |
|---|
| n/a |
|---|
| Name | BDBM50308110 |
|---|
| Synonyms: | (S,Z)-2-(5-((6-(2,3-dimethoxyphenyl)pyridin-3-yl)methylene)-4-oxo-2-thioxothiazolidin-3-yl)-3-phenylpropanoic acid | CHEMBL605114 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C26H22N2O5S2 |
|---|
| Mol. Mass. | 506.593 |
|---|
| SMILES | COc1cccc(c1OC)-c1ccc(\C=C2/SC(=S)N([C@@H](Cc3ccccc3)C(O)=O)C2=O)cn1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
