| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Cathepsin B-like cysteine protease |
|---|
| Ligand | BDBM50311252 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_619863 (CHEMBL1109344) |
|---|
| IC50 | 16000±n/a nM |
|---|
| Citation |  Bryant, C; Kerr, ID; Debnath, M; Ang, KK; Ratnam, J; Ferreira, RS; Jaishankar, P; Zhao, D; Arkin, MR; McKerrow, JH; Brinen, LS; Renslo, AR Novel non-peptidic vinylsulfones targeting the S2 and S3 subsites of parasite cysteine proteases. Bioorg Med Chem Lett19:6218-21 (2009) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Cathepsin B-like cysteine protease |
|---|
| Name: | Cathepsin B-like cysteine protease |
|---|
| Synonyms: | CPC | Cathepsin B-Like Cysteine Protease (TbcatB) | Cysteine peptidase C | TbcatB |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 37220.37 |
|---|
| Organism: | Trypanosoma brucei |
|---|
| Description: | Enzyme was expressed in yeast Pichia pastoris. |
|---|
| Residue: | 340 |
|---|
| Sequence: | MHLMRACITFCIASTAVVAVNAALVAEDAPVLSKAFVDRVNRLNRGIWKAKYDGVMQNIT
LREAKRLNGVIKKNNNASILPKRRFTEEEARAPLPSSFDSAEAWPNCPTIPQIADQSACG
SCWAVAAASAMSDRFCTMGGVQDVHISAGDLLACCSDCGDGCNGGDPDRAWAYFSSTGLV
SDYCQPYPFPHCSHHSKSKNGYPPCSQFNFDTPKCNYTCDDPTIPVVNYRSWTSYALQGE
DDYMRELFFRGPFEVAFDVYEDFIAYNSGVYHHVSGQYLGGHAVRLVGWGTSNGVPYWKI
ANSWNTEWGMDGYFLIRRGSSECGIEDGGSAGIPLAPNTA
|
|
|
|---|
| BDBM50311252 |
|---|
| n/a |
|---|
| Name | BDBM50311252 |
|---|
| Synonyms: | (1R,2R)-2-(4-chlorobenzoyl)-N-((S)-5-phenyl-1-(phenylsulfonyl)pent-1-en-3-yl)cyclohexanecarboxamide | CHEMBL1079162 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C31H32ClNO4S |
|---|
| Mol. Mass. | 550.108 |
|---|
| SMILES | Clc1ccc(cc1)C(=O)[C@@H]1CCCC[C@H]1C(=O)N[C@@H](CCc1ccccc1)C=CS(=O)(=O)c1ccccc1 |r,w:28.31| |
|---|
| Structure | 
|
|---|
Search and Browse
