| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Nociceptin receptor |
|---|
| Ligand | BDBM50311483 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_622960 (CHEMBL1112212) |
|---|
| IC50 | 339±n/a nM |
|---|
| Citation |  Palin, R; Clark, JK; Evans, L; Feilden, H; Fletcher, D; Hamilton, NM; Houghton, AK; Jones, PS; McArthur, D; Montgomery, B; Ratcliffe, PD; Smith, AR; Sutherland, A; Weston, MA; Wishart, G Rapid access towards follow-up NOP receptor agonists using a knowledge based approach. Bioorg Med Chem Lett19:6441-6 (2009) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Nociceptin receptor |
|---|
| Name: | Nociceptin receptor |
|---|
| Synonyms: | KOR-3 | Kappa-type 3 opioid receptor | Mu-type opioid receptor (Mu) | NOP | Nociceptin Receptor (ORL1 Receptor) | Nociceptin receptor (NOP) | Nociceptin receptor (ORL-1) | Nociceptin receptor (ORL1) | Nociceptin/Orphanin FQ, NOP receptor | OOR | OPIATE ORL-1 | OPRL1 | OPRL1 protein | OPRX_HUMAN | ORL1 | ORL1 receptor | Opioid receptor like-1 | Orphanin FQ receptor | Orphanin FQ receptor (ORL1) | P41146 |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 40702.87 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P41146 |
|---|
| Residue: | 370 |
|---|
| Sequence: | MEPLFPAPFWEVIYGSHLQGNLSLLSPNHSLLPPHLLLNASHGAFLPLGLKVTIVGLYLA
VCVGGLLGNCLVMYVILRHTKMKTATNIYIFNLALADTLVLLTLPFQGTDILLGFWPFGN
ALCKTVIAIDYYNMFTSTFTLTAMSVDRYVAICHPIRALDVRTSSKAQAVNVAIWALASV
VGVPVAIMGSAQVEDEEIECLVEIPTPQDYWGPVFAICIFLFSFIVPVLVISVCYSLMIR
RLRGVRLLSGSREKDRNLRRITRLVLVVVAVFVGCWTPVQVFVLAQGLGVQPSSETAVAI
LRFCTALGYVNSCLNPILYAFLDENFKACFRKFCCASALRRDVQVSDRVRSIAKDVALAC
KTSETVPRPA
|
|
|
|---|
| BDBM50311483 |
|---|
| n/a |
|---|
| Name | BDBM50311483 |
|---|
| Synonyms: | 2-[3-(1-Cycloheptyl-piperidin-4-yl)-2,2-dioxo-2,3-dihydro-2lambda*6*-benzo[1,2,5]thiadiazol-1-yl]-N-methyl-acetamide | CHEMBL1079417 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H32N4O3S |
|---|
| Mol. Mass. | 420.569 |
|---|
| SMILES | CNC(=O)CN1c2ccccc2N(C2CCN(CC2)C2CCCCCC2)S1(=O)=O |
|---|
| Structure | 
|
|---|
Search and Browse
