| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Carbonic anhydrase |
|---|
| Ligand | BDBM25916 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_626038 (CHEMBL1106166) |
|---|
| Ki | 94±n/a nM |
|---|
| Citation |  Güzel, O; Maresca, A; Hall, RA; Scozzafava, A; Mastrolorenzo, A; Mühlschlegel, FA; Supuran, CT Carbonic anhydrase inhibitors. The beta-carbonic anhydrases from the fungal pathogens Cryptococcus neoformans and Candida albicans are strongly inhibited by substituted-phenyl-1H-indole-5-sulfonamides. Bioorg Med Chem Lett20:2508-11 (2010) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Carbonic anhydrase |
|---|
| Name: | Carbonic anhydrase |
|---|
| Synonyms: | CAN_CANAL | NCE103 | beta-Carbonic Anhydrase |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 31587.59 |
|---|
| Organism: | Candida albicans (Yeast) |
|---|
| Description: | n/a |
|---|
| Residue: | 281 |
|---|
| Sequence: | MGRENILKYQLEHDHESDLVTEKDQSLLLDNNNNLNGMNNTIKTHPVRVSSGNHNNFPFT
LSSESTLQDFLNNNKFFVDSIKHNHGNQIFDLNGQGQSPHTLWIGCSDSRAGDQCLATLP
GEIFVHRNIANIVNANDISSQGVIQFAIDVLKVKKIIVCGHTDCGGIWASLSKKKIGGVL
DLWLNPVRHIRAANLKLLEEYNQDPKLKAKKLAELNVISSVTALKRHPSASVALKKNEIE
VWGMLYDVATGYLSQVEIPQDEFEDLFHVHDEHDEEEYNPH
|
|
|
|---|
| BDBM25916 |
|---|
| n/a |
|---|
| Name | BDBM25916 |
|---|
| Synonyms: | 3-(4-bromophenyl)-2-(hydrazinecarbonyl)-1H-indole-5-sulfonamide | BMC173212 Compound 2l | indole sulfonamide, 8l |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C15H13BrN4O3S |
|---|
| Mol. Mass. | 409.258 |
|---|
| SMILES | NNC(=O)c1[nH]c2ccc(cc2c1-c1ccc(Br)cc1)S(N)(=O)=O |
|---|
| Structure | 
|
|---|
Search and Browse
