Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCyclin-dependent kinase 1
LigandBDBM50277583
Substrate/Competitorn/a
Meas. Tech.ChEMBL_634454
Ki>10000±n/a nM
Citation Wang SMidgley CAScaërou FGrabarek JBGriffiths GJackson WKontopidis GMcClue SJMcInnes CMeades CMezna MPlater AStuart IThomas MPWood GClarke RGBlake DGZheleva DILane DPJackson RCGlover DMFischer PM Discovery of N-phenyl-4-(thiazol-5-yl)pyrimidin-2-amine aurora kinase inhibitors. J Med Chem 53:4367-78 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cyclin-dependent kinase 1
Name:Cyclin-dependent kinase 1/G1/S-specific cyclin-D1
Synonyms:Cell division control protein 2 homolog | Cell division protein kinase 1 | Cyclin-dependent kinase 1 (CDK1) | p34 protein kinase
Type:Enzyme Subunit
Mol. Mass.:34101.08
Organism:Homo sapiens (Human)
Description:P06493
Residue:297
Sequence:
MEDYTKIEKIGEGTYGVVYKGRHKTTGQVVAMKKIRLESEEEGVPSTAIREISLLKELRH
PNIVSLQDVLMQDSRLYLIFEFLSMDLKKYLDSIPPGQYMDSSLVKSYLYQILQGIVFCH
SRRVLHRDLKPQNLLIDDKGTIKLADFGLARAFGIPIRVYTHEVVTLWYRSPEVLLGSAR
YSTPVDIWSIGTIFAELATKKPLFHGDSEIDQLFRIFRALGTPNNEVWPEVESLQDYKNT
FPKWKPGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHPYFNDLDNQIKKM
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50277583
n/a
NameBDBM50277583
Synonyms:2-amino-4-methyl-1,3-thiazol-5-yl)-N-[4-(morpholin-4-yl)phenyl]pyrimidin-2-amine, 5 | 4-Methyl-5-(2-(4-morpholinophenylamino)pyrimidin-4-yl)thiazol-2-amine | Aminopyrimidine, 9 | CHEMBL482967 | CYC-116
TypeSmall organic molecule
Emp. Form.C18H20N6OS
Mol. Mass.368.456
SMILESCc1nc(N)sc1-c1ccnc(Nc2ccc(cc2)N2CCOCC2)n1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: