Reaction Details |
| Report a problem with these data |
Target | Ileal sodium/bile acid cotransporter |
---|
Ligand | BDBM50322495 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_643281 (CHEMBL1177270) |
---|
Ki | 126000±n/a nM |
---|
Citation | Rais, R; Acharya, C; Tririya, G; Mackerell, AD; Polli, JE Molecular switch controlling the binding of anionic bile acid conjugates to human apical sodium-dependent bile acid transporter. J Med Chem53:4749-60 (2010) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Ileal sodium/bile acid cotransporter |
---|
Name: | Ileal sodium/bile acid cotransporter |
Synonyms: | ASBT | Apical sodium-dependent bile acid transporter | IBAT | ISBT | Ileal Na(+)/bile acid cotransporter | Ileal bile acid transporter | Ileal bile acid transporter/bile acid cotransporter | Ileal sodium-dependent bile acid transporter | NTCP2 | NTCP2_HUMAN | SLC10A2 |
Type: | Enzyme |
Mol. Mass.: | 37714.89 |
Organism: | Homo sapiens (Human) |
Description: | SLC10A2 |
Residue: | 348 |
Sequence: | MNDPNSCVDNATVCSGASCVVPESNFNNILSVVLSTVLTILLALVMFSMGCNVEIKKFLG
HIKRPWGICVGFLCQFGIMPLTGFILSVAFDILPLQAVVVLIIGCCPGGTASNILAYWVD
GDMDLSVSMTTCSTLLALGMMPLCLLIYTKMWVDSGSIVIPYDNIGTSLVSLVVPVSIGM
FVNHKWPQKAKIILKIGSIAGAILIVLIAVVGGILYQSAWIIAPKLWIIGTIFPVAGYSL
GFLLARIAGLPWYRCRTVAFETGMQNTQLCSTIVQLSFTPEELNVVFTFPLIYSIFQLAF
AAIFLGFYVAYKKCHGKNKAEIPESKENGTEPESSFYKANGGFQPDEK
|
|
|
BDBM50322495 |
---|
n/a |
---|
Name | BDBM50322495 |
Synonyms: | 3-(((4S)-4-carboxylato-4-((4R)-4-((3R,7R,8R,9S,10S,13R,14S,17R)-3,7-dihydroxy-10,13-dimethylhexadecahydro-1H-cyclopenta[a]phenanthren-17-yl)pentanamido)butanamido)methyl)benzoate | CHEMBL1170257 |
Type | Small organic molecule |
Emp. Form. | C37H54N2O8 |
Mol. Mass. | 654.8333 |
SMILES | C[C@H](CCC(=O)N[C@@H](CCC(=O)NCc1cccc(c1)C(O)=O)C(O)=O)[C@H]1CC[C@H]2[C@@H]3[C@H](O)C[C@H]4C[C@H](O)CC[C@]4(C)[C@H]3CC[C@]12C |r| |
Structure |
|