| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Ileal sodium/bile acid cotransporter |
|---|
| Ligand | BDBM50322495 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_643281 (CHEMBL1177270) |
|---|
| Ki | 126000±n/a nM |
|---|
| Citation |  Rais, R; Acharya, C; Tririya, G; Mackerell, AD; Polli, JE Molecular switch controlling the binding of anionic bile acid conjugates to human apical sodium-dependent bile acid transporter. J Med Chem53:4749-60 (2010) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Ileal sodium/bile acid cotransporter |
|---|
| Name: | Ileal sodium/bile acid cotransporter |
|---|
| Synonyms: | ASBT | Apical sodium-dependent bile acid transporter | IBAT | ISBT | Ileal Na(+)/bile acid cotransporter | Ileal bile acid transporter | Ileal bile acid transporter/bile acid cotransporter | Ileal sodium-dependent bile acid transporter | NTCP2 | NTCP2_HUMAN | SLC10A2 |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 37714.89 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | SLC10A2 |
|---|
| Residue: | 348 |
|---|
| Sequence: | MNDPNSCVDNATVCSGASCVVPESNFNNILSVVLSTVLTILLALVMFSMGCNVEIKKFLG
HIKRPWGICVGFLCQFGIMPLTGFILSVAFDILPLQAVVVLIIGCCPGGTASNILAYWVD
GDMDLSVSMTTCSTLLALGMMPLCLLIYTKMWVDSGSIVIPYDNIGTSLVSLVVPVSIGM
FVNHKWPQKAKIILKIGSIAGAILIVLIAVVGGILYQSAWIIAPKLWIIGTIFPVAGYSL
GFLLARIAGLPWYRCRTVAFETGMQNTQLCSTIVQLSFTPEELNVVFTFPLIYSIFQLAF
AAIFLGFYVAYKKCHGKNKAEIPESKENGTEPESSFYKANGGFQPDEK
|
|
|
|---|
| BDBM50322495 |
|---|
| n/a |
|---|
| Name | BDBM50322495 |
|---|
| Synonyms: | 3-(((4S)-4-carboxylato-4-((4R)-4-((3R,7R,8R,9S,10S,13R,14S,17R)-3,7-dihydroxy-10,13-dimethylhexadecahydro-1H-cyclopenta[a]phenanthren-17-yl)pentanamido)butanamido)methyl)benzoate | CHEMBL1170257 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C37H54N2O8 |
|---|
| Mol. Mass. | 654.8333 |
|---|
| SMILES | C[C@H](CCC(=O)N[C@@H](CCC(=O)NCc1cccc(c1)C(O)=O)C(O)=O)[C@H]1CC[C@H]2[C@@H]3[C@H](O)C[C@H]4C[C@H](O)CC[C@]4(C)[C@H]3CC[C@]12C |r| |
|---|
| Structure | 
|
|---|
Search and Browse
