Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarbonic Anhydrase III
LigandBDBM10883
Substrate/Competitorn/a
Meas. Tech.ChEMBL_646955
Ki 680000±n/a nM
Citation Carta FTemperini CInnocenti AScozzafava AKaila KSupuran CT Polyamines inhibit carbonic anhydrases by anchoring to the zinc-coordinated water molecule. J Med Chem 53:5511-22 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Carbonic Anhydrase III
Name:Carbonic Anhydrase III
Synonyms:CA-III | Carbonate dehydratase III | Carbonic anhydrase 3 (CA III) | Carbonic anhydrase III (CA III)
Type:Enzyme
Mol. Mass.:29562.11
Organism:Homo sapiens (Human)
Description:Human cloned isozyme.
Residue:260
Sequence:
MAKEWGYASHNGPDHWHELFPNAKGENQSPVELHTKDIRHDPSLQPWSVSYDGGSAKTIL
NNGKTCRVVFDDTYDRSMLRGGPLPGPYRLRQFHLHWGSSDDHGSEHTVDGVKYAAELHL
VHWNPKYNTFKEALKQRDGIAVIGIFLKIGHENGEFQIFLDALDKIKTKGKEAPFTKFDP
SCLFPACRDYWTYQGSFTTPPCEECIVWLLLKEPMTVSSDQMAKLRSLLSSAENEPPVPL
VSNWRPPQPINNRVVRASFK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM10883
n/a
NameBDBM10883
Synonyms:4,5-dichlorobenzene-1,3-disulfonamide | CHEMBL17 | Dichlorophenamide | Dichlorophenamide (DCP) | Dichlorophenamide, DCP | Sulfonamide, 4 | US10172837, Dichlorphenamide | sulfonamide 4
TypeSmall organic molecule
Emp. Form.C6H6Cl2N2O4S2
Mol. Mass.305.159
SMILESNS(=O)(=O)c1cc(Cl)c(Cl)c(c1)S(N)(=O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: