| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sigma non-opioid intracellular receptor 1 |
|---|
| Ligand | BDBM50324098 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_649647 (CHEMBL1219345) |
|---|
| Ki | 2.6±n/a nM |
|---|
| Citation |  Moussa, IA; Banister, SD; Beinat, C; Giboureau, N; Reynolds, AJ; Kassiou, M Design, synthesis, and structure-affinity relationships of regioisomeric N-benzyl alkyl ether piperazine derivatives as sigma-1 receptor ligands. J Med Chem53:6228-39 (2010) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Sigma non-opioid intracellular receptor 1 |
|---|
| Name: | Sigma non-opioid intracellular receptor 1 |
|---|
| Synonyms: | Opioid receptor | Oprs1 | SGMR1_RAT | Sigma | Sigma non-opioid intracellular receptor 1 | Sigma opioid receptor | Sigma-1 | Sigmar1 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 25266.54 |
|---|
| Organism: | RAT |
|---|
| Description: | Q9R0C9 |
|---|
| Residue: | 223 |
|---|
| Sequence: | MPWAVGRRWAWITLFLTIVAVLIQAVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSHGHSGRY
WAEISDTIISGTFHQWREGTTKSEVYYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALSDTIFSTQDFLTLFYTLRAYARGLRLELTTYLFGQDP
|
|
|
|---|
| BDBM50324098 |
|---|
| n/a |
|---|
| Name | BDBM50324098 |
|---|
| Synonyms: | CHEMBL1214891 | N-(Benzofuran-2-ylmethyl)-N'-(4'-(2''-fluoroethoxy)benzyl)-piperazine |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C23H26F2N2O2 |
|---|
| Mol. Mass. | 400.4615 |
|---|
| SMILES | FC(F)CCOc1ccc(CN2CCN(Cc3cc4ccccc4o3)CC2)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
