Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMonoglyceride Lipase (MGL)
LigandBDBM50132717
Substrate/Competitorn/a
Meas. Tech.ChEMBL_653421
IC50 0.8±n/a nM
Citation Nomura DKBlankman JLSimon GMFujioka KIssa RSWard AMCravatt BFCasida JE Activation of the endocannabinoid system by organophosphorus nerve agents. Nat Chem Biol 4:373-8 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Monoglyceride Lipase (MGL)
Name:Monoglyceride Lipase (MGL)
Synonyms:MAG lipase | Monoacylglycerol lipase
Type:Hydrolase
Mol. Mass.:33391.67
Organism:Mus musculus (mouse)
Description:Assays were using membranes of recombinant MAG Lipase transiently transfected in COS-7 cells.
Residue:303
Sequence:
MPEASSPRRTPQNVPYQDLPHLVNADGQYLFCRYWKPSGTPKALIFVSHGAGEHCGRYDE
LAHMLKGLDMLVFAHDHVGHGQSEGERMVVSDFQVFVRDVLQHVDTIQKDYPDVPIFLLG
HSMGGAISILVAAERPTYFSGMVLISPLVLANPESASTLKVLAAKLLNFVLPNMTLGRID
SSVLSRNKSEVDLYNSDPLVCRAGLKVCFGIQLLNAVARVERAMPRLTLPFLLLQGSADR
LCDSKGAYLLMESSRSQDKTLKMYEGAYHVLHRELPEVTNSVLHEVNSWVSHRIAAAGAG
CPP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50132717
n/a
NameBDBM50132717
Synonyms:CHEMBL333149 | Isopropyl dodecylfluorophosphonate | isopropyl dodecylphosphonofluoridate | isopropyl dodecylphosphonofluoridoate
TypeSmall organic molecule
Emp. Form.C15H32FO2P
Mol. Mass.294.3855
SMILESCCCCCCCCCCCCP(F)(=O)OC(C)C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: