Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAnandamide amidohydrolase
LigandBDBM50132717
Substrate/Competitorn/a
Meas. Tech.ChEMBL_653616
IC50 3±n/a nM
Citation Nomura DKBlankman JLSimon GMFujioka KIssa RSWard AMCravatt BFCasida JE Activation of the endocannabinoid system by organophosphorus nerve agents. Nat Chem Biol 4:373-8 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Anandamide amidohydrolase
Name:Anandamide amidohydrolase
Synonyms:Anandamide amidohydrolase 1 | Fatty Acid Amide Hydrolase | Fatty-acid amide hydrolase (FAAH) | Fatty-acid amide hydrolase 1 | Oleamide hydrolase 1
Type:Hydrolase; single-pass membrane protein; homodimer
Mol. Mass.:63227.28
Organism:Mus musculus (mouse)
Description:Mouse brain membranes were used in the assay.
Residue:579
Sequence:
MVLSEVWTALSGLSGVCLACSLLSAAVVLRWTRSQTARGAVTRARQKQRAGLETMDKAVQ
RFRLQNPDLDSEALLALPLLQLVQKLQSGELSPEAVLFTYLGKAWEVNKGTNCVTSYLTD
CETQLSQAPRQGLLYGVPVSLKECFSYKGHASTLGLSLNEGVTSESDCVVVQVLKLQGAV
PFVHTNVPQSMLSYDCSNPLFGQTMNPWKPSKSPGGSSGGEGALIGSGGSPLGLGTDIGG
SIRFPSAFCGICGLKPTGNRLSKSGLKSCVYGQTAVQLSVGPMARDVDSLALCMKALLCE
DLFRLDSTIPPLPFREEIYRSSRPLRVGYYETDNYTMPTPAMRRAVMETKQSLEAAGHTL
VPFLPNNIPYALEVLSAGGLFSDGGCSFLQNFKGDFVDPCLGDLVLVLKLPRWFKKLLSF
LLKPLFPRLAAFLNSMCPRSAEKLWELQHEIEMYRQSVIAQWKAMNLDVVLTPMLGPALD
LNTPGRATGAISYTVLYNCLDFPAGVVPVTTVTAEDDAQMEHYKGYFGDMWDNILKKGMK
KGIGLPVAVQCVALPWQEELCLRFMREVERLMTPEKRPS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50132717
n/a
NameBDBM50132717
Synonyms:CHEMBL333149 | Isopropyl dodecylfluorophosphonate | isopropyl dodecylphosphonofluoridate | isopropyl dodecylphosphonofluoridoate
TypeSmall organic molecule
Emp. Form.C15H32FO2P
Mol. Mass.294.3855
SMILESCCCCCCCCCCCCP(F)(=O)OC(C)C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: