| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Ubiquitin carboxyl-terminal hydrolase isozyme L3 |
|---|
| Ligand | BDBM50326015 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_654656 (CHEMBL1243700) |
|---|
| IC50 | 47000±n/a nM |
|---|
| Citation |  Love, KR; Catic, A; Schlieker, C; Ploegh, HL Mechanisms, biology and inhibitors of deubiquitinating enzymes. Nat Chem Biol3:697-705 (2007) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Ubiquitin carboxyl-terminal hydrolase isozyme L3 |
|---|
| Name: | Ubiquitin carboxyl-terminal hydrolase isozyme L3 |
|---|
| Synonyms: | UCHL3 | UCHL3_HUMAN | Ubiquitin C-terminal Hydrolase L3 (UCH-L3) | Ubiquitin thioesterase L3 |
|---|
| Type: | Hydrolase; protease |
|---|
| Mol. Mass.: | 26168.69 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Human recombinant UCH-L3 was purchased from Boston Biochem, Inc.(Cambridge, MA). |
|---|
| Residue: | 230 |
|---|
| Sequence: | MEGQRWLPLEANPEVTNQFLKQLGLHPNWQFVDVYGMDPELLSMVPRPVCAVLLLFPITE
KYEVFRTEEEEKIKSQGQDVTSSVYFMKQTISNACGTIGLIHAIANNKDKMHFESGSTLK
KFLEESVSMSPEERARYLENYDAIRVTHETSAHEGQTEAPSIDEKVDLHFIALVHVDGHL
YELDGRKPFPINHGETSDETLLEDAIEVCKKFMERDPDELRFNAIALSAA
|
|
|
|---|
| BDBM50326015 |
|---|
| n/a |
|---|
| Name | BDBM50326015 |
|---|
| Synonyms: | 5-(4-butylphenyl)-4-(4-isopropylphenyl)-4H-1,2,4-triazole-3-thiol | CHEMBL1241766 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H25N3S |
|---|
| Mol. Mass. | 351.508 |
|---|
| SMILES | CCCCc1ccc(cc1)-c1n[nH]c(=S)n1-c1ccc(cc1)C(C)C |
|---|
| Structure | 
|
|---|
Search and Browse
