Reaction Details |
| Report a problem with these data |
Target | Chymase |
---|
Ligand | BDBM50326055 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_656008 (CHEMBL1245052) |
---|
IC50 | >10000±n/a nM |
---|
Citation | Liverton, NJ; Carroll, SS; Dimuzio, J; Fandozzi, C; Graham, DJ; Hazuda, D; Holloway, MK; Ludmerer, SW; McCauley, JA; McIntyre, CJ; Olsen, DB; Rudd, MT; Stahlhut, M; Vacca, JP MK-7009, a potent and selective inhibitor of hepatitis C virus NS3/4A protease. Antimicrob Agents Chemother54:305-11 (2009) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Chymase |
---|
Name: | Chymase |
Synonyms: | Alpha-chymase | CMA1 | CMA1_HUMAN | CYH | CYM | Chymase precursor | Mast cell protease I |
Type: | Enzyme |
Mol. Mass.: | 27340.12 |
Organism: | Homo sapiens (Human) |
Description: | n/a |
Residue: | 247 |
Sequence: | MLLLPLPLLLFLLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNF
VLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKA
SLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRD
FDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWI
NQILQAN
|
|
|
BDBM50326055 |
---|
n/a |
---|
Name | BDBM50326055 |
Synonyms: | (1R,21S,24S)-21-tert-Butyl-N-((1R,2R)-1-{[(cyclopropylsulfonyl)amino]carbonyl}-2-ethylcyclopropyl)-16,16-dimethyl-3,19,22-trioxo-2,18-dioxa-4,20,23-triazatetracyclo[21.2.1.14,7.06,11]-heptacosa-6,8,10-triene-24-carboxamide | (1R,21S,24S)-21-tert-butyl-N-((1R,2R)-1-{[(cyclopropylsulfonyl)amino]carbonyl}-2-ethylcyclopropyl)-16,16-dimethyl-3,19,22-trioxo-2,18-dioxa-4,20,23-triazatetracyclo[21.2.1.14,70.06,11]heptacosa-6,8,10-triene-24-carboxamide | CHEMBL599872 | MK-7009 |
Type | Small organic molecule |
Emp. Form. | C38H53N5O9S |
Mol. Mass. | 755.921 |
SMILES | CC(C)(C)[C@@H]1NC(=O)OCC(C)(C)CCCCc2cccc3CN(Cc23)C(=O)O[C@@H]2C[C@H](N(C2)C1=O)C(=O)N[C@@]1(C[C@H]1C=C)C(=O)NS(=O)(=O)C1CC1 |r| |
Structure |
|