| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Adenosine receptor A1 |
|---|
| Ligand | BDBM50327327 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_664373 (CHEMBL1259522) |
|---|
| IC50 | 1.39±n/a nM |
|---|
| Citation |  Griebenow, N; Bärfacker, L; Meier, H; Schneider, D; Teusch, N; Lustig, K; Kast, R; Kolkhof, P Identification and optimization of substituted 5-aminopyrazoles as potent and selective adenosine A1 receptor antagonists. Bioorg Med Chem Lett20:5891-4 (2010) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Adenosine receptor A1 |
|---|
| Name: | Adenosine receptor A1 |
|---|
| Synonyms: | A1 adenosine receptor (hA1) | A1AR | AA1R_HUMAN | ADENOSINE A1 | ADORA1 | Adenosine A1 receptor (A1AR) | Adenosine A1-receptor | Adenosine receptor A1 (A1) | Adenosine receptor A1 (hA1) | Adenosine transporter (AdT) |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 36520.92 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P30542 |
|---|
| Residue: | 326 |
|---|
| Sequence: | MPPSISAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIVSLAVADVAVGA
LVIPLAILINIGPQTYFHTCLMVACPVLILTQSSILALLAIAVDRYLRVKIPLRYKMVVT
PRRAAVAIAGCWILSFVVGLTPMFGWNNLSAVERAWAANGSMGEPVIKCEFEKVISMEYM
VYFNFFVWVLPPLLLMVLIYLEVFYLIRKQLNKKVSASSGDPQKYYGKELKIAKSLALIL
FLFALSWLPLHILNCITLFCPSCHKPSILTYIAIFLTHGNSAMNPIVYAFRIQKFRVTFL
KIWNDHFRCQPAPPIDEDLPEERPDD
|
|
|
|---|
| BDBM50327327 |
|---|
| n/a |
|---|
| Name | BDBM50327327 |
|---|
| Synonyms: | 2-(4-(4-fluorophenyl)-3-methyl-1-o-tolyl-1H-pyrazol-5-ylamino)-5-methoxybenzoic acid | CHEMBL1257826 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C25H22FN3O3 |
|---|
| Mol. Mass. | 431.4589 |
|---|
| SMILES | COc1ccc(Nc2c(c(C)nn2-c2ccccc2C)-c2ccc(F)cc2)c(c1)C(O)=O |
|---|
| Structure | 
|
|---|
Search and Browse
