Reaction Details |
| Report a problem with these data |
Target | Carbonic anhydrase 1 |
---|
Ligand | BDBM50240416 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_673811 (CHEMBL1274988) |
---|
IC50 | 338±n/a nM |
---|
Citation | Innocenti, A; Supuran, CT Paraoxon, 4-nitrophenyl phosphate and acetate are substrates ofa- but not ofß-,¿- and¿-carbonic anhydrases. Bioorg Med Chem Lett20:6208-12 (2010) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Carbonic anhydrase 1 |
---|
Name: | Carbonic anhydrase 1 |
Synonyms: | CA-I | CA1 | CAB | CAH1_HUMAN | Carbonate dehydratase I | Carbonic anhydrase | Carbonic anhydrase 1 (CA I) | Carbonic anhydrase 1 (CA-I) | Carbonic anhydrase 1 (Recombinant CA I) | Carbonic anhydrase 2 (CA II) | Carbonic anhydrase B | Carbonic anhydrase I | Carbonic anhydrase I (CA I) | Carbonic anhydrase I (CA-I) | Carbonic anhydrase I (CAI) | Carbonic anhydrase I (hCA I) | Carbonic anhydrase isoenzyme I (hCA I) | hCA |
Type: | Enzyme |
Mol. Mass.: | 28873.37 |
Organism: | Homo sapiens (Human) |
Description: | P00915 |
Residue: | 261 |
Sequence: | MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEI
INVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELH
VAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNF
DPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAV
PMQHNNRPTQPLKGRTVRASF
|
|
|
BDBM50240416 |
---|
n/a |
---|
Name | BDBM50240416 |
Synonyms: | CHEMBL23838 | O,O-diethyl O-p-nitrophenyl phosphate | diethyl 4-nitrophenyl phosphate | diethyl p-nitrophenyl phosphate | diethyl paraoxon | ethyl paraoxon | p-nitrophenyl diethyl phosphate | paraoxon | phosphacol | phosphoric acid diethyl 4-nitrophenyl ester |
Type | Small organic molecule |
Emp. Form. | C10H14NO6P |
Mol. Mass. | 275.195 |
SMILES | CCOP(=O)(OCC)Oc1ccc(cc1)[N+]([O-])=O |
Structure |
|