Reaction Details |
| Report a problem with these data |
Target | Carbonic anhydrase 13 |
---|
Ligand | BDBM50240416 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_673817 (CHEMBL1274994) |
---|
IC50 | 1021±n/a nM |
---|
Citation | Innocenti, A; Supuran, CT Paraoxon, 4-nitrophenyl phosphate and acetate are substrates ofa- but not ofß-,¿- and¿-carbonic anhydrases. Bioorg Med Chem Lett20:6208-12 (2010) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Carbonic anhydrase 13 |
---|
Name: | Carbonic anhydrase 13 |
Synonyms: | CA-XIII | CAH13_MOUSE | Ca13 | Car13 | Carbonate dehydratase XIII | Carbonic anhydrase 13 | Carbonic anhydrase XIII |
Type: | Enzyme |
Mol. Mass.: | 29522.80 |
Organism: | Mus musculus (mouse) |
Description: | Murine cloned isozyme |
Residue: | 262 |
Sequence: | MARLSWGYGEHNGPIHWNELFPIADGDQQSPIEIKTKEVKYDSSLRPLSIKYDPASAKII
SNSGHSFNVDFDDTEDKSVLRGGPLTGNYRLRQFHLHWGSADDHGSEHVVDGVRYAAELH
VVHWNSDKYPSFVEAAHESDGLAVLGVFLQIGEHNPQLQKITDILDSIKEKGKQTRFTNF
DPLCLLPSSWDYWTYPGSLTVPPLLESVTWIVLKQPISISSQQLARFRSLLCTAEGESAA
FLLSNHRPPQPLKGRRVRASFY
|
|
|
BDBM50240416 |
---|
n/a |
---|
Name | BDBM50240416 |
Synonyms: | CHEMBL23838 | O,O-diethyl O-p-nitrophenyl phosphate | diethyl 4-nitrophenyl phosphate | diethyl p-nitrophenyl phosphate | diethyl paraoxon | ethyl paraoxon | p-nitrophenyl diethyl phosphate | paraoxon | phosphacol | phosphoric acid diethyl 4-nitrophenyl ester |
Type | Small organic molecule |
Emp. Form. | C10H14NO6P |
Mol. Mass. | 275.195 |
SMILES | CCOP(=O)(OCC)Oc1ccc(cc1)[N+]([O-])=O |
Structure |
|