| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Apoptosis regulator Bcl-2 |
|---|
| Ligand | BDBM50329390 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_675633 (CHEMBL1273941) |
|---|
| Ki | 40±n/a nM |
|---|
| Citation |  Petros, AM; Huth, JR; Oost, T; Park, CM; Ding, H; Wang, X; Zhang, H; Nimmer, P; Mendoza, R; Sun, C; Mack, J; Walter, K; Dorwin, S; Gramling, E; Ladror, U; Rosenberg, SH; Elmore, SW; Fesik, SW; Hajduk, PJ Discovery of a potent and selective Bcl-2 inhibitor using SAR by NMR. Bioorg Med Chem Lett20:6587-91 (2010) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Apoptosis regulator Bcl-2 |
|---|
| Name: | Apoptosis regulator Bcl-2 |
|---|
| Synonyms: | Apoptosis regulator Bcl-2 Protein | B-cell lymphoma 2 protein (Bcl-2) | BCL-2 | BCL2 | BCL2_HUMAN | Bcl-2 Protein |
|---|
| Type: | Homodimer or heterodimer |
|---|
| Mol. Mass.: | 26269.11 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P10415 |
|---|
| Residue: | 239 |
|---|
| Sequence: | MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPA
ASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLH
LTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEY
LNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
|
|
|
|---|
| BDBM50329390 |
|---|
| n/a |
|---|
| Name | BDBM50329390 |
|---|
| Synonyms: | 4'-(5-(1-(4-tert-butylphenyl)-1-hydroxy-3-(pyrrolidin-1-yl)propyl)-2-chlorophenethoxy)biphenyl-4-carboxylic acid | CHEMBL1269507 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C38H42ClNO4 |
|---|
| Mol. Mass. | 612.197 |
|---|
| SMILES | CC(C)(C)c1ccc(cc1)C(O)(CCN1CCCC1)c1ccc(Cl)c(CCOc2ccc(cc2)-c2ccc(cc2)C(O)=O)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
