| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Bcl-2-like protein 1 |
|---|
| Ligand | BDBM50329369 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_675632 (CHEMBL1273940) |
|---|
| Kd | 500000±n/a nM |
|---|
| Citation |  Petros, AM; Huth, JR; Oost, T; Park, CM; Ding, H; Wang, X; Zhang, H; Nimmer, P; Mendoza, R; Sun, C; Mack, J; Walter, K; Dorwin, S; Gramling, E; Ladror, U; Rosenberg, SH; Elmore, SW; Fesik, SW; Hajduk, PJ Discovery of a potent and selective Bcl-2 inhibitor using SAR by NMR. Bioorg Med Chem Lett20:6587-91 (2010) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Bcl-2-like protein 1 |
|---|
| Name: | Bcl-2-like protein 1 |
|---|
| Synonyms: | Anti-apoptotic Bcl-2 protein | Apoptosis Regulator Bcl-xL | Apoptosis regulator Bcl-X | B2CL1_HUMAN | BCL2-like 1 isoform 1 | BCL2L | BCL2L1 | BCLX | Bcl-2-like protein 1 (Bcl-XL) | Bcl-X | Bcl-xL/Bcl-2-binding component 3 | Bcl2-L-1 | Bcl2-antagonist of cell death (BAD) |
|---|
| Type: | Mitochondrion membrane; Single-pass membrane protein |
|---|
| Mol. Mass.: | 26039.60 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | n/a |
|---|
| Residue: | 233 |
|---|
| Sequence: | MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLA
DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY
QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEP
WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
|
|
|
|---|
| BDBM50329369 |
|---|
| n/a |
|---|
| Name | BDBM50329369 |
|---|
| Synonyms: | (R)-1-(4-chlorophenyl)-4-(dimethylamino)-1-phenylbutan-1-ol | CHEMBL1270617 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C18H22ClNO |
|---|
| Mol. Mass. | 303.826 |
|---|
| SMILES | CN(C)CCCC(O)(c1ccccc1)c1ccc(Cl)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
