| Reaction Details |
|---|
 | Report a problem with these data |
| Target | VIM-13 |
|---|
| Ligand | BDBM50092158 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_678225 (CHEMBL1280220) |
|---|
| IC50 | 69300±n/a nM |
|---|
| Citation |  Juan, C; Beceiro, A; Gutiérrez, O; Albertí, S; Garau, M; Pérez, JL; Bou, G; Oliver, A Characterization of the new metallo-beta-lactamase VIM-13 and its integron-borne gene from a Pseudomonas aeruginosa clinical isolate in Spain. Antimicrob Agents Chemother52:3589-96 (2008) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| VIM-13 |
|---|
| Name: | VIM-13 |
|---|
| Synonyms: | Class B carbapenemase VIM-13 | Metallo-beta-lactamase VIM-13 | VIM-13 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 28208.69 |
|---|
| Organism: | Pseudomonas aeruginosa |
|---|
| Description: | ChEMBL_678225 |
|---|
| Residue: | 266 |
|---|
| Sequence: | MLKVISSLLFYMTASLMAVASPLAHSGESRGEYPTVSEIPVGEVRLYQIDDGVWSHIATH
TFDGVVYPSNGLIVRDGDELLLIDTAWGTKNTVALLAEIEKQIGLPVTRSVSTHFHDDRV
GGVDALRAAGVATYASPSTRRLAEAEGNEVPTHSLEGLSSSGDAVRFGPVELFYPGAAHS
TDNLVVYVPSANVLYGGCAVLELSRTSAGNVADADLAEWPGSVERIQQHYPEAEVVIPGH
GLPGGLDLLQHTANVVKAHTNRSVAE
|
|
|
|---|
| BDBM50092158 |
|---|
| n/a |
|---|
| Name | BDBM50092158 |
|---|
| Synonyms: | 1,10-phenanthroline | CHEMBL415879 | US10669227, Compound 1,10-phenanthroline | US11608309, Compound 1,10-phenanthroline | US9187406, 1,10-phenanthroline | cid_1318 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C12H8N2 |
|---|
| Mol. Mass. | 180.2053 |
|---|
| SMILES | c1cnc2c(c1)ccc1cccnc21 |
|---|
| Structure | 
|
|---|
Search and Browse
