Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPurine Nucleoside Phosphorylase (PNP)
LigandBDBM50330393
Substrate/Competitorn/a
Meas. Tech.ChEMBL_684503
IC50>1000000±n/a nM
Citation Cui HRuda GFCarrero-Lérida JRuiz-Pérez LMGilbert IHGonzález-Pacanowska D Exploring new inhibitors of Plasmodium falciparum purine nucleoside phosphorylase. Eur J Med Chem 45:5140-9 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Purine Nucleoside Phosphorylase (PNP)
Name:Purine Nucleoside Phosphorylase (PNP)
Synonyms:pfPNP
Type:Enzyme
Mol. Mass.:26857.85
Organism:Plasmodium falciparum
Description:n/a
Residue:245
Sequence:
MDNLLRHLKISKEQITPVVLVVGDPGRVDKIKVVCDSYVDLAYNREYKSVECHYKGQKFL
CVSHGVGSAGCAVCFEELCQNGAKVIIRAGSCGSLQPDLIKRGDICICNAAVREDRVSHL
LIHGDFPAVGDFDVYDTLNKCAQELNVPVFNGISVSSDMYYPNKIIPSRLEDYSKANAAV
VEMELATLMVIGTLRKVKTGGILIVDGCPFKWDEGDFDNNLVPHQLENMIKIALGACAKL
ATKYA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50330393
n/a
NameBDBM50330393
Synonyms:5-benzylpyrimidine-2,4,6(1H,3H,5H)-trione | CHEMBL1275661
TypeSmall organic molecule
Emp. Form.C11H10N2O3
Mol. Mass.218.2087
SMILESOc1[nH]c(=O)[nH]c(=O)c1Cc1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: