| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Histamine H3 receptor |
|---|
| Ligand | BDBM35229 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_685426 (CHEMBL1285325) |
|---|
| Ki | >5000±n/a nM |
|---|
| Citation |  Altenbach, RJ; Black, LA; Strakhova, MI; Manelli, AM; Carr, TL; Marsh, KC; Wetter, JM; Wensink, EJ; Hsieh, GC; Honore, P; Garrison, TR; Brioni, JD; Cowart, MD Diaryldiamines with dual inhibition of the histamine H(3) receptor and the norepinephrine transporter and the efficacy of 4-(3-(methylamino)-1-phenylpropyl)-6-(2-(pyrrolidin-1-yl)ethoxy)naphthalen-1-ol in pain. J Med Chem53:7869-73 (2010) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Histamine H3 receptor |
|---|
| Name: | Histamine H3 receptor |
|---|
| Synonyms: | G-protein coupled receptor 97 | GPCR97 | HH3R | HISTAMINE H3 | HRH3 | HRH3_HUMAN | Histamine H3 receptor (H3) | Histamine H3L | Histamine receptor (H3 and H4) |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 48691.47 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Binding assays were using CHO cells stably expressing hH3R receptors. |
|---|
| Residue: | 445 |
|---|
| Sequence: | MERAPPDGPLNASGALAGEAAAAGGARGFSAAWTAVLAALMALLIVATVLGNALVMLAFV
ADSSLRTQNNFFLLNLAISDFLVGAFCIPLYVPYVLTGRWTFGRGLCKLWLVVDYLLCTS
SAFNIVLISYDRFLSVTRAVSYRAQQGDTRRAVRKMLLVWVLAFLLYGPAILSWEYLSGG
SSIPEGHCYAEFFYNWYFLITASTLEFFTPFLSVTFFNLSIYLNIQRRTRLRLDGAREAA
GPEPPPEAQPSPPPPPGCWGCWQKGHGEAMPLHRYGVGEAAVGAEAGEATLGGGGGGGSV
ASPTSSSGSSSRGTERPRSLKRGSKPSASSASLEKRMKMVSQSFTQRFRLSRDRKVAKSL
AVIVSIFGLCWAPYTLLMIIRAACHGHCVPDYWYETSFWLLWANSAVNPVLYPLCHHSFR
RAFTKLLCPQKLKIQPHSSLEHCWK
|
|
|
|---|
| BDBM35229 |
|---|
| n/a |
|---|
| Name | BDBM35229 |
|---|
| Synonyms: | 3-(10,11-dihydro-5H-dibenzo[b,f]azepin-5-yl)-N-methylpropan-1-amine | 5-(gamma-methylaminopropyl)iminodibenzyl | CHEMBL72 | DESIPRAMINE HYDROCHLORIDE | DMI | Desipramin | Desipramine | Desmethylimipramine | N-(3-methylaminopropyl)iminobibenzyl | US9944618, Compound ID No. 174 | demethylimipramine | monodemethylimipramine | norimipramine |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C18H22N2 |
|---|
| Mol. Mass. | 266.3807 |
|---|
| SMILES | CNCCCN1c2ccccc2CCc2ccccc12 |
|---|
| Structure | 
|
|---|
Search and Browse
