| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Low molecular weight protein-tyrosine phosphatase A |
|---|
| Ligand | BDBM50331864 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_686940 (CHEMBL1291351) |
|---|
| Ki | 199100±n/a nM |
|---|
| Citation |  Chandra, K; Dutta, D; Das, AK; Basak, A Design, synthesis and inhibition activity of novel cyclic peptides against protein tyrosine phosphatase A from Mycobacterium tuberculosis. Bioorg Med Chem18:8365-73 (2010) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Low molecular weight protein-tyrosine phosphatase A |
|---|
| Name: | Low molecular weight protein-tyrosine phosphatase A |
|---|
| Synonyms: | PTPA_MYCTU | PTPase | Probable low molecular weight protein-tyrosine-phosphatase | Protein Tyrosine Phosphatase PTPA | mptpA | ptpA |
|---|
| Type: | Hydrolase |
|---|
| Mol. Mass.: | 17891.84 |
|---|
| Organism: | Mycobacterium tuberculosis |
|---|
| Description: | n/a |
|---|
| Residue: | 163 |
|---|
| Sequence: | MSDPLHVTFVCTGNICRSPMAEKMFAQQLRHRGLGDAVRVTSAGTGNWHVGSCADERAAG
VLRAHGYPTDHRAAQVGTEHLAADLLVALDRNHARLLRQLGVEAARVRMLRSFDPRSGTH
ALDVEDPYYGDHSDFEEVFAVIESALPGLHDWVDERLARNGPS
|
|
|
|---|
| BDBM50331864 |
|---|
| n/a |
|---|
| Name | BDBM50331864 |
|---|
| Synonyms: | 3,6,9-Trimethyl-12-(phenyl-phenylamino-methyl)-1,4,7,10 tetraaza-cyclotridecane-2,5,8,11-tetraone | CHEMBL1289671 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C25H31N5O4 |
|---|
| Mol. Mass. | 465.5447 |
|---|
| SMILES | C[C@@H]1NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@H](CNC1=O)[C@@H](Nc1ccccc1)c1ccccc1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
