| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Zn finger protein |
|---|
| Ligand | BDBM50332027 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_687568 (CHEMBL1290840) |
|---|
| Ki | 8.8±n/a nM |
|---|
| Citation |  Maresca, A; Scozzafava, A; Supuran, CT 7,8-disubstituted- but not 6,7-disubstituted coumarins selectively inhibit the transmembrane, tumor-associated carbonic anhydrase isoforms IX and XII over the cytosolic ones I and II in the low nanomolar/subnanomolar range. Bioorg Med Chem Lett20:7255-8 (2010) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Zn finger protein |
|---|
| Name: | Zn finger protein |
|---|
| Synonyms: | n/a |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 25827.13 |
|---|
| Organism: | Nicotiana tabacum |
|---|
| Description: | ChEMBL_687568 |
|---|
| Residue: | 234 |
|---|
| Sequence: | LPLPFFNMDTSHWPQGIGLAKAVEPSKPVPVTERKPRPQKEQAINCPRCNSTNTKFCYYN
NYSLSQPRYFCKTCRRYWTDGGSLRNVPVGGGSRKNKRSNSSSNNSSSSTSSSYKKIPDL
TIPTSSSTQNPKIINEPHDLNLTFNPSTTSNFSNISEFMALPLMNPNSTTSFMSSIMPQI
SDSNNIMYSSSSTGLPNLHDLKPTLNFSLDGFDNNNGYGSLQGETAGAKLFFPL
|
|
|
|---|
| BDBM50332027 |
|---|
| n/a |
|---|
| Name | BDBM50332027 |
|---|
| Synonyms: | 8-acetyl-7-butoxy-2H-chromen-2-one | CHEMBL1288620 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C15H16O4 |
|---|
| Mol. Mass. | 260.2851 |
|---|
| SMILES | CCCCOc1ccc2ccc(=O)oc2c1C(C)=O |
|---|
| Structure | 
|
|---|
Search and Browse
