Reaction Details |
| Report a problem with these data |
Target | Tyrosine-protein phosphatase non-receptor type 7 |
---|
Ligand | BDBM50233538 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_699963 (CHEMBL1646370) |
---|
IC50 | >300000±n/a nM |
---|
Citation | Scott, LM; Chen, L; Daniel, KG; Brooks, WH; Guida, WC; Lawrence, HR; Sebti, SM; Lawrence, NJ; Wu, J Shp2 protein tyrosine phosphatase inhibitor activity of estramustine phosphate and its triterpenoid analogs. Bioorg Med Chem Lett21:730-3 (2011) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Tyrosine-protein phosphatase non-receptor type 7 |
---|
Name: | Tyrosine-protein phosphatase non-receptor type 7 |
Synonyms: | He-PTP | Hematopoietic protein-tyrosine phosphatase | Hematopoietic protein-tyrosine phosphatase (HEPTP) | PTN7_HUMAN | PTPN7 | Protein-tyrosine phosphatase LC-PTP | Tyrosine-protein phosphatase non-receptor type 7 | Tyrosine-protein phosphatase non-receptor type 7 (HEPTP) |
Type: | Protein |
Mol. Mass.: | 40530.79 |
Organism: | Homo sapiens (Human) |
Description: | P35236 |
Residue: | 360 |
Sequence: | MVQAHGGRSRAQPLTLSLGAAMTQPPPEKTPAKKHVRLQERRGSNVALMLDVRSLGAVEP
ICSVNTPREVTLHFLRTAGHPLTRWALQRQPPSPKQLEEEFLKIPSNFVSPEDLDIPGHA
SKDRYKTILPNPQSRVCLGRAQSQEDGDYINANYIRGYDGKEKVYIATQGPMPNTVSDFW
EMVWQEEVSLIVMLTQLREGKEKCVHYWPTEEETYGPFQIRIQDMKECPEYTVRQLTIQY
QEERRSVKHILFSAWPDHQTPESAGPLLRLVAEVEESPETAAHPGPIVVHCSAGIGRTGC
FIATRIGCQQLKARGEVDILGIVCQLRLDRGGMIQTAEQYQFLHHTLALYAGQLPEEPSP
|
|
|
BDBM50233538 |
---|
n/a |
---|
Name | BDBM50233538 |
Synonyms: | 18beta-glycyrrhetic acid | 3beta-hydroxy-11-oxoolean-12-en-30-oic acid | CHEMBL230006 | US11660306, Example 18beta Glycyrrhetinic acid | glycyrrhetinic acid |
Type | Small organic molecule |
Emp. Form. | C30H46O4 |
Mol. Mass. | 470.6838 |
SMILES | CC1(C)[C@@H](O)CC[C@@]2(C)[C@H]1CC[C@]1(C)[C@@H]2C(=O)C=C2[C@@H]3C[C@](C)(CC[C@]3(C)CC[C@@]12C)C(O)=O |r,t:19| |
Structure |
|