Reaction Details |
| Report a problem with these data |
Target | Sigma non-opioid intracellular receptor 1 |
---|
Ligand | BDBM50334162 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_698206 (CHEMBL1646511) |
---|
Ki | 6.2±n/a nM |
---|
Citation | Maestrup, EG; Wiese, C; Schepmann, D; Brust, P; Wünsch, B Synthesis, pharmacological activity and structure affinity relationships of spirocyclics(1) receptor ligands with a (2-fluoroethyl) residue in 3-position. Bioorg Med Chem19:393-405 (2011) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sigma non-opioid intracellular receptor 1 |
---|
Name: | Sigma non-opioid intracellular receptor 1 |
Synonyms: | OPRS1 | SGMR1_CAVPO | SIGMAR1 | Sigma 1-type opioid receptor | Sigma non-opioid intracellular receptor 1 | Sigma-1 receptor | Sigma1-receptor | Sigma1R | Sterol isomerase-like protein |
Type: | Protein |
Mol. Mass.: | 25307.17 |
Organism: | Cavia porcellus (Guinea pig) |
Description: | Q60492 |
Residue: | 223 |
Sequence: | MQWAVGRRWLWVALFLAAVAVLTQIVWLWLGTQNFVFQREEIAQLARQYAGLDHELAFSK
LIVELRRLHPVHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSPRHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLGFALADTVFSTQDFLTLFYTLRVYARALQLELTTYLFGQDP
|
|
|
BDBM50334162 |
---|
n/a |
---|
Name | BDBM50334162 |
Synonyms: | 2-[1'-(4-Fluorobenzyl)-3H-spiro[[2]benzofuran-1,4'-piperidin]-3yl]ethanol | CHEMBL1645206 |
Type | Small organic molecule |
Emp. Form. | C21H24FNO2 |
Mol. Mass. | 341.4192 |
SMILES | OCCC1OC2(CCN(Cc3ccc(F)cc3)CC2)c2ccccc12 |
Structure |
|