| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Beta-carbonic anhydrase 1 |
|---|
| Ligand | BDBM50334359 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_700107 (CHEMBL1646989) |
|---|
| Ki | 473±n/a nM |
|---|
| Citation |  Pacchiano, F; Carta, F; Vullo, D; Scozzafava, A; Supuran, CT Inhibition ofß-carbonic anhydrases with ureido-substituted benzenesulfonamides. Bioorg Med Chem Lett21:102-5 (2010) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Beta-carbonic anhydrase 1 |
|---|
| Name: | Beta-carbonic anhydrase 1 |
|---|
| Synonyms: | β-Carbonic anhydrase 1 (CA 1) | Carbonic Anhydrase (mtCA 1) | MTCA1_MYCTU | Uncharacterized protein Rv1284/MT1322 | canA | mtcA1 |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 18186.06 |
|---|
| Organism: | Mycobacterium tuberculosis |
|---|
| Description: | The recombinant GST-mtCA1 construct was cloned, expressed, and further purified from E. coli. The purified protein was used in inhibition assays. |
|---|
| Residue: | 163 |
|---|
| Sequence: | MTVTDDYLANNVDYASGFKGPLPMPPSKHIAIVACMDARLDVYRMLGIKEGEAHVIRNAG
CVVTDDVIRSLAISQRLLGTREIILLHHTDCGMLTFTDDDFKRAIQDETGIRPTWSPESY
PDAVEDVRQSLRRIEVNPFVTKHTSLRGFVFDVATGKLNEVTP
|
|
|
|---|
| BDBM50334359 |
|---|
| n/a |
|---|
| Name | BDBM50334359 |
|---|
| Synonyms: | 4-(3-(2-methoxyphenyl)ureido)benzenesulfonamide | 4-{[(2'-Methoxyphenyl)amino]carbonyl)}aminobenzenesulfonamide | CHEMBL1643294 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C14H15N3O4S |
|---|
| Mol. Mass. | 321.352 |
|---|
| SMILES | COc1ccccc1NC(=O)Nc1ccc(cc1)S(N)(=O)=O |
|---|
| Structure | 
|
|---|
Search and Browse
