| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Translocator protein |
|---|
| Ligand | BDBM50336501 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_720286 (CHEMBL1679152) |
|---|
| IC50 | >30000000±n/a nM |
|---|
| Citation |  Nyanguile, O; Pauwels, F; Van den Broeck, W; Boutton, CW; Quirynen, L; Ivens, T; van der Helm, L; Vandercruyssen, G; Mostmans, W; Delouvroy, F; Dehertogh, P; Cummings, MD; Bonfanti, JF; Simmen, KA; Raboisson, P 1,5-benzodiazepines, a novel class of hepatitis C virus polymerase nonnucleoside inhibitors. Antimicrob Agents Chemother52:4420-31 (2008) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Translocator protein |
|---|
| Name: | Translocator protein |
|---|
| Synonyms: | BZRP | MBR | Mitochondrial benzodiazepine receptor | PBR | PKBS | Peripheral benzodiazepine receptor-related protein | Peripheral-type benzodiazepine receptor | TSPO | TSPO_HUMAN |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 18834.74 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P30536 |
|---|
| Residue: | 169 |
|---|
| Sequence: | MAPPWVPAMGFTLAPSLGCFVGSRFVHGEGLRWYAGLQKPSWHPPHWVLGPVWGTLYSAM
GYGSYLVWKELGGFTEKAVVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLLLVSGAAA
ATTVAWYQVSPLAARLLYPYLAWLAFTTTLNYCVWRDNHGWRGGRRLPE
|
|
|
|---|
| BDBM50336501 |
|---|
| n/a |
|---|
| Name | BDBM50336501 |
|---|
| Synonyms: | 10-acetyl-11-(4-(benzyloxy)-2-chlorophenyl)-6-hydroxy-3,3-dimethyl-2,3,4,5,10,11-hexahydro-1H-dibenzo[b,e][1,4]diazepin-1-one | CHEMBL512949 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C30H29ClN2O4 |
|---|
| Mol. Mass. | 517.015 |
|---|
| SMILES | CC(=O)N1C(C2C(=O)CC(C)(C)CC2=Nc2c(O)cccc12)c1ccc(OCc2ccccc2)cc1Cl |c:14| |
|---|
| Structure | 
|
|---|
Search and Browse
