| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Mu-type opioid receptor |
|---|
| Ligand | BDBM50336671 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_722917 (CHEMBL1674428) |
|---|
| Ki | 0.12±n/a nM |
|---|
| Citation |  Nemoto, T; Yamamoto, N; Watanabe, A; Fujii, H; Hasebe, K; Nakajima, M; Mochizuki, H; Nagase, H Synthesis of 6,14-epoxymorphinan derivatives and their pharmacologies. Bioorg Med Chem19:1205-21 (2011) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Mu-type opioid receptor |
|---|
| Name: | Mu-type opioid receptor |
|---|
| Synonyms: | M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1 | OPRM_CAVPO |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 11165.58 |
|---|
| Organism: | GUINEA PIG |
|---|
| Description: | P97266 |
|---|
| Residue: | 98 |
|---|
| Sequence: | YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
|
|
|
|---|
| BDBM50336671 |
|---|
| n/a |
|---|
| Name | BDBM50336671 |
|---|
| Synonyms: | CHEMBL1672479 | N-[(17-Cyclopropylmethyl-6beta,14beta-epoxy-3-hydroxymorphinan-6alpha-yl)methyl]-4-hydroxybenzamide |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C28H32N2O4 |
|---|
| Mol. Mass. | 460.5647 |
|---|
| SMILES | Oc1ccc(cc1)C(=O)NC[C@@]12CC[C@@]3(O1)[C@H]1Cc4ccc(O)cc4[C@]3(C2)CCN1CC1CC1 |r,THB:30:29:14:24.18.17| |
|---|
| Structure | 
|
|---|
Search and Browse
