| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Adenosine receptor A3 |
|---|
| Ligand | BDBM50336991 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_719013 (CHEMBL1679075) |
|---|
| Ki | 326±n/a nM |
|---|
| Citation |  Eastwood, P; Esteve, C; González, J; Fonquerna, S; Aiguadé, J; Carranco, Is; Doménech, T; Aparici, Ms; Miralpeix, M; Albertí, J; Córdoba, M; Fernández, R; Pont, Ms; Godessart, Ns; Prats, N; Loza, Ms; Cadavid, Ms; Nueda, A Discovery of LAS101057: A Potent, Selective, and Orally Efficacious A2B Adenosine Receptor Antagonist ACS Med Chem Lett2:213-218 (2011) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Adenosine receptor A3 |
|---|
| Name: | Adenosine receptor A3 |
|---|
| Synonyms: | A3 adenosine receptor (hA3) | AA3R_HUMAN | ADORA3 | Adenosine A3 receptor (A3AR) |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 36197.32 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P0DMS8 |
|---|
| Residue: | 318 |
|---|
| Sequence: | MPNNSTALSLANVTYITMEIFIGLCAIVGNVLVICVVKLNPSLQTTTFYFIVSLALADIA
VGVLVMPLAIVVSLGITIHFYSCLFMTCLLLIFTHASIMSLLAIAVDRYLRVKLTVRYKR
VTTHRRIWLALGLCWLVSFLVGLTPMFGWNMKLTSEYHRNVTFLSCQFVSVMRMDYMVYF
SFLTWIFIPLVVMCAIYLDIFYIIRNKLSLNLSNSKETGAFYGREFKTAKSLFLVLFLFA
LSWLPLSIINCIIYFNGEVPQLVLYMGILLSHANSMMNPIVYAYKIKKFKETYLLILKAC
VVCHPSDSLDTSIEKNSE
|
|
|
|---|
| BDBM50336991 |
|---|
| n/a |
|---|
| Name | BDBM50336991 |
|---|
| Synonyms: | CHEMBL1672623 | N-[6-(2-Fluorophenyl)-5-pyridin-4-ylpyrazin-2-yl]cyclopropanecarboxamide |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C19H15FN4O |
|---|
| Mol. Mass. | 334.347 |
|---|
| SMILES | Fc1ccccc1-c1nc(NC(=O)C2CC2)cnc1-c1ccncc1 |
|---|
| Structure | 
|
|---|
Search and Browse
