| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sigma non-opioid intracellular receptor 1 |
|---|
| Ligand | BDBM50206199 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_727395 (CHEMBL1685123) |
|---|
| Ki | 880±n/a nM |
|---|
| Citation |  Fan, KH; Lever, JR; Lever, SZ Effect of structural modification in the amine portion of substituted aminobutyl-benzamides as ligands for bindings1 ands2 receptors. Bioorg Med Chem19:1852-9 (2011) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Sigma non-opioid intracellular receptor 1 |
|---|
| Name: | Sigma non-opioid intracellular receptor 1 |
|---|
| Synonyms: | OPRS1 | SGMR1_CAVPO | SIGMAR1 | Sigma 1-type opioid receptor | Sigma non-opioid intracellular receptor 1 | Sigma-1 receptor | Sigma1-receptor | Sigma1R | Sterol isomerase-like protein |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 25307.17 |
|---|
| Organism: | Cavia porcellus (Guinea pig) |
|---|
| Description: | Q60492 |
|---|
| Residue: | 223 |
|---|
| Sequence: | MQWAVGRRWLWVALFLAAVAVLTQIVWLWLGTQNFVFQREEIAQLARQYAGLDHELAFSK
LIVELRRLHPVHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSPRHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLGFALADTVFSTQDFLTLFYTLRVYARALQLELTTYLFGQDP
|
|
|
|---|
| BDBM50206199 |
|---|
| n/a |
|---|
| Name | BDBM50206199 |
|---|
| Synonyms: | CHEMBL391153 | N-(4-(3,4-dimethoxyphenethylamino)butyl)-5-bromo-2,3-dimethoxybenzamide |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C23H31BrN2O5 |
|---|
| Mol. Mass. | 495.407 |
|---|
| SMILES | COc1ccc(CCNCCCCNC(=O)c2cc(Br)cc(OC)c2OC)cc1OC |
|---|
| Structure | 
|
|---|
Search and Browse
